KEGG   Equus asinus (ass): 106838266Help
Entry
106838266         CDS       T04645                                 

Gene name
GYS1, GSY1, GYS
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
eai  Equus asinus (ass)
Pathway
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04151  PI3K-Akt signaling pathway
eai04152  AMPK signaling pathway
eai04910  Insulin signaling pathway
eai04922  Glucagon signaling pathway
eai04931  Insulin resistance
Module
eai_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106838266 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    106838266 (GYS1)
   04152 AMPK signaling pathway
    106838266 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106838266 (GYS1)
   04922 Glucagon signaling pathway
    106838266 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    106838266 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:eai01003]
    106838266 (GYS1)
Enzymes [BR:eai01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     106838266 (GYS1)
Glycosyltransferases [BR:eai01003]
 Polysaccharide
  Storage polysaccharide
   106838266 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 106838266
NCBI-ProteinID: XP_014707744
LinkDB All DBs
Position
Un
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLDDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCTHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALAKAFPEHFTYEPREADATQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EEPRDVPPDEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRGSVDTGPSSSLS
TPSEPLSPASSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctctaaaccgcactttgtccatgtcctcactgccaggactggacgattgggaggat
gaattcgacctggagaatacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctacagacgaaggcgaaggtgacaggggatgaatggggcgat
aactactacctggtgggaccatacacggagcaaggcgtgaggacccaggtggagctgctc
gagcccccaaccccggccctgaagaggacactggactccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgaggggggccccctggtggtgctcctggatgtgggg
gcctcagcctgggccctggaacgctggaagggagagctttgggacacctgcaacatcggg
gtgccctggtacgaccgtgaggccaacgacgccgtcctttttggcttcctcaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcacacttccac
gagtggttggcaggcatcgggctctgcctgtgccgtgcccggcggctgcctgtggctaca
atcttcaccacccacgccacgctgctggggcgatacctgtgtgccggtgctgtggacttc
tacaacaacctggagaatttcaacgtggacaaggaagctggtgagaggcaaatttatcac
cgttactgcatggagcgggcggcagcccactgcactcacgtcttcactaccgtgtcccag
atcaccgccattgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggcccgaatccaggagtttgtgcgtggccatttttatgggcacctggacttcaacttg
gataagaccctgtatttctttatcgccggccgctacgagttctccaacaagggggctgac
gtcttcctggaggccttggcccggctcaactatctgctcagagtaaatggcagcgagcag
acggtggtcgccttcttcatcatgccggctcggaccaacaacttcaacgtggaaaccctc
aaggggcaagccgtgcgcaagcagctctgggatacggcgaacacagtgaaggagaagttc
gggaggaagctttacgaatccctgctggttgggagcctcccagacatgaacaagatgctg
gacaaggaggatttcactatgatgaagagagccatctttgccacgcagcggcagtctttt
ccccctgtgtgcacccacaatatgctggacgactcctcggaccctatcctgaccaccatc
cgtcgaatcggcctcttcaatagtagtgctgacagggtcaaggtgattttccacccagag
ttcctctcctccacgagccccctgctccccgtggactatgaggagtttgtccgtggctgc
cacctcggggttttcccctcctactatgagccttggggctacacaccggctgagtgcacg
gttatgggcatccccagtgtctccaccaacctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggcatctacattctggaccggcggttccgcagcctg
gatgattcctgctcgcagcttacctccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtccgcgcgccacatggcgctggccaaggcctttccagaacac
ttcacctacgagccccgcgaggctgatgcgacccagggctaccgctacccacggcctgca
tcagtgcctccgtcgccctcactgtcacgacactcgagcccgcaccagagcgaggacgag
gaggagccccgggacgtgccgcccgatgaagacggtgagcgctacgacgaggacgaggag
gccgccaaggaccggcgcaacatccgcgccccggagtggccgcgtcgcgcctcctgcacc
tcttccacgagcgggagcaagcgcggctcggtggacacggggccctccagctcgctcagc
acccccagcgagcccctcagccccgccagctccctgggcgaggagcgcaactaa

DBGET integrated database retrieval system