KEGG   Equus asinus (ass): 106838858Help
Entry
106838858         CDS       T04645                                 

Gene name
MGST2
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eai  Equus asinus (ass)
Pathway
eai00480  Glutathione metabolism
eai00980  Metabolism of xenobiotics by cytochrome P450
eai00982  Drug metabolism - cytochrome P450
eai00983  Drug metabolism - other enzymes
eai01524  Platinum drug resistance
eai05200  Pathways in cancer
eai05204  Chemical carcinogenesis
eai05225  Hepatocellular carcinoma
eai05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:eai00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    106838858 (MGST2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106838858 (MGST2)
   00982 Drug metabolism - cytochrome P450
    106838858 (MGST2)
   00983 Drug metabolism - other enzymes
    106838858 (MGST2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    106838858 (MGST2)
   05204 Chemical carcinogenesis
    106838858 (MGST2)
   05225 Hepatocellular carcinoma
    106838858 (MGST2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    106838858 (MGST2)
  Drug resistance
   01524 Platinum drug resistance
    106838858 (MGST2)
Enzymes [BR:eai01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106838858 (MGST2)
Transporters [BR:eai02000]
 Other Transporters
  Pores ion channels [TC:1]
   106838858 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 106838858
NCBI-ProteinID: XP_014708716
LinkDB All DBs
Position
Un
AA seq 146 aa AA seqDB search
MAGNSILLAAVSLLSACQQSYFAFQVGRARLKYKIMPPAVSGSPEFDRIFRAQQNSVEFY
PAFMITLWMAGWYFNQVFATCLGLVYIYARHQYFWGYSEAANKRMTGFRLGLGILALLAI
LGALGIANSFLDEYLDLNVAKKLRHF
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atggctgggaattcaatcttgctagctgctgtctctctcctctccgcctgtcagcaaagt
tattttgcttttcaagtaggaagggcaagattaaaatacaaaattatgcccccggcagtc
tctgggtcaccagaatttgacagaatatttcgtgcacaacaaaacagtgtggagttttac
cccgcattcatgattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatctatgcccgtcaccagtatttctggggatattcagaagct
gctaacaaaaggatgactggtttccggttgggtctggggattttggccttgttggccatc
ctgggcgccctggggattgcaaacagctttctggatgaatacctagacctcaatgttgcc
aagaaactgaggcatttctaa

DBGET integrated database retrieval system