KEGG   Equus asinus (ass): 106839051
Entry
106839051         CDS       T04645                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
eai  Equus asinus (ass)
Pathway
eai01521  EGFR tyrosine kinase inhibitor resistance
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04015  Rap1 signaling pathway
eai04020  Calcium signaling pathway
eai04072  Phospholipase D signaling pathway
eai04144  Endocytosis
eai04151  PI3K-Akt signaling pathway
eai04510  Focal adhesion
eai04540  Gap junction
eai04630  JAK-STAT signaling pathway
eai04810  Regulation of actin cytoskeleton
eai05163  Human cytomegalovirus infection
eai05200  Pathways in cancer
eai05206  MicroRNAs in cancer
eai05214  Glioma
eai05215  Prostate cancer
eai05218  Melanoma
eai05230  Central carbon metabolism in cancer
eai05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106839051 (PDGFRA)
   04014 Ras signaling pathway
    106839051 (PDGFRA)
   04015 Rap1 signaling pathway
    106839051 (PDGFRA)
   04630 JAK-STAT signaling pathway
    106839051 (PDGFRA)
   04020 Calcium signaling pathway
    106839051 (PDGFRA)
   04072 Phospholipase D signaling pathway
    106839051 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    106839051 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    106839051 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106839051 (PDGFRA)
   04540 Gap junction
    106839051 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106839051 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106839051 (PDGFRA)
   05206 MicroRNAs in cancer
    106839051 (PDGFRA)
   05230 Central carbon metabolism in cancer
    106839051 (PDGFRA)
   05231 Choline metabolism in cancer
    106839051 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    106839051 (PDGFRA)
   05218 Melanoma
    106839051 (PDGFRA)
   05215 Prostate cancer
    106839051 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    106839051 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    106839051 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106839051 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:eai04090]
    106839051 (PDGFRA)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106839051 (PDGFRA)
Protein kinases [BR:eai01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   106839051 (PDGFRA)
CD molecules [BR:eai04090]
 Proteins
  106839051 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE LAT Kinase-like
Other DBs
NCBI-GeneID: 106839051
NCBI-ProteinID: XP_014708996
LinkDB
Position
Un
AA seq 1089 aa
MGTCHRALLVLGCLLTGPSLSFCQLSLPSILPNEDEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQTEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVTLLSSDGVVLASYDSRQGFNG
TFSVGPYICEATVKGKKFRTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKVPSIKLVYTLSVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPNFSRLEAVDLHEVKHFVVDVQAYPPPRISWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILANNISNIITEVHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLTPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKAMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttgccatcgggcactcctggtcttaggctgtctcctcacagggcccagccta
agcttctgccagctttcattaccctccatcctcccaaatgaagatgaaaaggttgtgcag
ctgaactcatccttttctctgagatgctttggggagagcgaagtgagctggcagtacccc
atgtctgaagaagagaaccctaacgtggaaatcagaaacgaggaaaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcagcagcccacacgggattgtacacttgc
tattacaaccacacgcagacagaagaaagcgagatcgaaggcaggcgtatttacatctat
gtgccagaccctgatgtggccttcgtacctctaggaatgacagactatttagtcatcgtg
gaggatgatgattctgccatcatcccttgtcgcacgactgatcctgagactccagtgacc
ttactcagcagtgatggggtggtactcgcctcctacgacagcagacagggctttaacgga
accttcagcgttgggccctacatctgcgaggccaccgtcaaagggaagaagtttcggacc
atcccatttaatgtttatgctttaaaagcaacatcagaacttgatctagagatggaagct
cttaagactgtgtataagtcgggggaaacgattgtggtcacctgcgccgtctttaacaac
gaggtggttgaccttcagtggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaggaaatcaaggtcccgtccatcaaattggtgtacaccctgagcgtccccgaggcc
acggtgaaagacagtggagattacgaatgtgccgcccgccaggccaccagggaggtcaaa
gaaatgaagaaagtcaccatttctgtccatgagaaaggtttcattgaaatcaaacccaac
ttcagccggctggaagccgttgacctgcatgaggtcaaacattttgtggtggatgtgcag
gcctacccgcctcctaggatatcctggctgaaggacaacctgactctgatcgaaaatctc
actgagatcaccactgacatagaaaagatccaggaaataaggtaccgaagcaaattaaag
ctgatccgtgcaaaggaagaagacagtggtcattatactattgtagttcaaaatgaagat
gatgtaaagagctatacctttgaactcttaactcaagttccctcatctattctggacttg
gtcgacgaccaccatggctctaccgggggtcagactgtgagatgcacagctgaagggacc
cctcttcctgacattgagtggatgatttgcaaggatattaagaaatgtaataatgaaact
tcgtggacgattttggctaacaacatctcaaacatcatcacggaggtccacccccgagac
aggagtactgtggagggccgagtgacgtttgccaaagtggaggagaccattgccgttcgg
tgtctggctaagaatctccttggggctgagaaccgagagctgaagctggtggctcccact
ctacgttctgaactcacagtggcagctgcggtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaagcagaaaccgaggtacgaaattcgttggagg
gtcattgaatcaatcagccctgatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcgagatgggagtttccaagagatggcctcgtgcttggtcgtatcctggga
tctggtgcgtttgggaaagtggtcgaaggaaccgcttatggattaagccggtcccaacct
gtcatgaaagtagctgtgaagatgctaaaacccacagccagatctagtgaaaaacaagct
ctcatgtcggaactgaagataatgactcacctggggccgcatttaaacattgtgaacttg
ctgggagcctgtaccaagtcaggcccaatttacatcatcacggagtactgcttctatggg
gatttggtcaactatttgcataagaatagggacagcttcctgagccgccacccagagaag
ccaaagaaagagctggacatctttggattgacccctgctgatgaaagcacacggagttat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaagctgataccaca
cagtatgtccccatgctggagaggaaagaggtttctaaatattcggacatccagaggtcg
ctgtatgatcgcccagcctcatataagaagaaagctatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggcctaactttgctggatttgttgagcttcacttat
caagttgcccgaggaatggagtttttggcttcaaagaattgtgtccaccgggacctggct
gctcgcaacgtcctcctggcacaagggaaaattgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattccaactacgtgtccaaaggcagcacctttctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacgctgagtgacgtctggtct
tacggcattctgctctgggagatcttttctcttggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccat
gccaccagtgaagtctatgagatcatggtgaagtgctggaacagtgagccggagaagagg
ccctccttttaccacctgagtgagatcgtggagaatctgctgcctggacaatataaaaag
agttatgaaaagattcacctggacttcctgaagagcgatcatcccgccgtggcacgcatg
cgcgtggactctgacaacgcctacattggcgtcacctacaaaaatgaggaagacaagctg
aaggactgggagggtggcctcgacgagcagaggttgagtgcggacagtggctacatcatc
cctctgccggacatcgaccctgttccggaggaggaagacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccatcgagacaggttccagcagttctaccttcatt
aagagagaggatgagaccattgaggacatcgacatgatggacgacattggcatagactcc
tcagacctggtggaggacagcttcctgtaa

DBGET integrated database retrieval system