KEGG   Equus asinus (ass): 106839089
Entry
106839089         CDS       T04645                                 

Gene name
SLC9A1
Definition
(RefSeq) solute carrier family 9 member A1
  KO
K05742  solute carrier family 9 (sodium/hydrogen exchanger), member 1
Organism
eai  Equus asinus (ass)
Pathway
eai04024  cAMP signaling pathway
eai04260  Cardiac muscle contraction
eai04261  Adrenergic signaling in cardiomyocytes
eai04371  Apelin signaling pathway
eai04810  Regulation of actin cytoskeleton
eai04919  Thyroid hormone signaling pathway
eai04970  Salivary secretion
eai04971  Gastric acid secretion
eai04972  Pancreatic secretion
eai04976  Bile secretion
eai05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106839089 (SLC9A1)
   04024 cAMP signaling pathway
    106839089 (SLC9A1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    106839089 (SLC9A1)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106839089 (SLC9A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106839089 (SLC9A1)
   04261 Adrenergic signaling in cardiomyocytes
    106839089 (SLC9A1)
  09154 Digestive system
   04970 Salivary secretion
    106839089 (SLC9A1)
   04971 Gastric acid secretion
    106839089 (SLC9A1)
   04972 Pancreatic secretion
    106839089 (SLC9A1)
   04976 Bile secretion
    106839089 (SLC9A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    106839089 (SLC9A1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eai01009]
    106839089 (SLC9A1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eai02000]
    106839089 (SLC9A1)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106839089 (SLC9A1)
Transporters [BR:eai02000]
 Solute carrier family (SLC)
  SLC9: Na+/H+ exchanger
   106839089 (SLC9A1)
SSDB
Motif
Pfam: Na_H_Exchanger NEXCaM_BD OprF
Other DBs
NCBI-GeneID: 106839089
NCBI-ProteinID: XP_014709066
LinkDB
Position
Un
AA seq 812 aa
MLWSGICGLSPPRIFPSLLVLVALVGLLPVLRSHDLQSSPTASTIRGSEPPRERSIGDVT
TAPPESPPESRPVNHSVTEHSMKTRKAFPVLGIDYSHVRTPFEISLWILLACLMKIGFHV
IPTISSIVPESCLLIVVGLLVGGLIKGVGETPPFLQSDVFFLFLLPPIILDAGYFLPLRQ
FTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGDEQISNIKLLDNLLFGSIISAVDPVA
VLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYDHVGIVDIVLGFLSFFVV
SLGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGV
VMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLIFC
LSLAGVLGLTWFINKFRIVKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMCELFLTA
IITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGH
HHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELVESGGMGKIPSAVST
VSMQNIHPKSLPAERILPALSKDKEEEIRKILRNNLQKTRQRLRSYNRHTLVADPYEEAW
NQMLLRRQKARQLEQKINNYLTVPAHKLDSPTMSRARIGSDPLAYEPKADLPVITIDPAS
PQSPESVDLVNEELKGKVLGLSRDPRLAEEDEDDDDGGIVMRTKEPSSPGTDDVFTPGPS
DSPSSQRIQRCLSDPGPHPEPGEGEPFIPKGQ
NT seq 2439 nt   +upstreamnt  +downstreamnt
atgctgtggtctggcatctgtggcctctcgccgcctcgaatcttcccttcgttgcttgtg
ttggtagccttggtggggttgctccctgttctcaggagccatgacctccagtccagccct
actgccagcaccatccgaggctcagagccaccacgggaacgctccattggggatgtcacc
accgccccaccggagtccccccctgagagccgccctgttaaccattccgtcactgaacat
agcatgaagactcgaaaggcctttccggttctggggattgactactcacacgtgcgcaca
ccctttgagatctccctctggatccttctggcttgcctcatgaagataggtttccatgtg
atccccaccatctcgagcatcgtcccagagagctgcctgctgatcgtggtggggctgctg
gtggggggcctgatcaagggcgttggggagacgccccccttcctgcagtcggacgtcttc
ttcctcttcctgctgccgcccatcatcctggatgcaggctacttcctgccactgcggcag
ttcacagagaacctgggcaccatcctgatcttcgccgtggtgggcacgctgtggaacgcc
ttcttcctgggcggcctcatgtatgccgtgtgcctggtgggtgacgagcagatcagcaac
attaaactcctggacaacctactcttcggcagcatcatctcagccgtggaccccgtggcc
gtgctggctgtctttgaggaaattcacatcaacgagctgctacatatcctcgtcttcggg
gagtccctgctcaatgacgccgtcactgtggtcctgtatcatctctttgaggagtttgcc
aactacgaccatgtgggcatcgtggacattgtccttggcttcctgagcttcttcgtggtg
tccttgggcggggtgtttgtgggcgtggtctacggggtcatcgcagccttcacctcccga
ttcacctcccacatccgcgtcatcgagccgctcttcgtcttcctctacagctacatggcc
tacctgtcagccgagctcttccacctgtcaggcatcatggcactcattgcctcgggagtg
gtgatgcgcccctacgtggaggccaacatctcccacaaatcccacacgaccatcaaatat
ttcctgaagatgtggagcagtgtcagcgagaccctcatcttcatcttcctcggcgtctcc
actgtggctggctcccaccactggaactggacctttgtcatcagcaccctaatcttttgc
ctttccctggcaggtgtgctaggcttgacctggttcatcaacaagttccgcatcgtgaag
ctgacccccaaggaccagttcatcatcgcatatgggggcctacgaggtgccatcgccttc
tccctgggctacctcctggacaagaagcacttcccaatgtgtgagctgttcctcactgcc
atcatcaccgtcatcttcttcaccgtctttgtacagggtatgaccattcgccccctggta
gacctgttggctgtgaagaaaaagcaagaaacgaagcgctccatcaatgaggagatccac
acgcagttcctggaccaccttctgacaggcatcgaggacatctgtggccactacggccac
caccactggaaggacaagctgaaccggtttaataagaagtacgtgaagaagtgtctgata
gctggcgagcgctccaaggagccccagctcatcgccttctaccacaagatggagatgaag
caggctattgagctggtggaaagtgggggcatgggcaagatcccctccgccgtctccacc
gtctccatgcagaatatccaccccaagtccctgcctgctgagcgcatcctgccagcactg
tccaaggacaaggaggaggagatccgcaaaatcctgaggaacaacttgcagaagaccagg
cagcggctgcggtcctacaacagacacacgctggtggcagacccctacgaggaggcctgg
aaccagatgctgctccggagacagaaggcccggcaactagagcagaagatcaacaactac
ctgacggtgcctgcccacaagctggactcgcccaccatgtcacgggcccgcatcggctca
gacccgctggcctatgagccaaaggccgacttgcctgttatcaccatcgacccagcctcc
ccgcagtcgcctgagtccgtggacctggtgaatgaggagctgaagggcaaggtcttgggg
ctgagccgggatccaaggttggctgaggaggacgaggatgatgacgatgggggcattgtg
atgcggaccaaagagccttcgtccccaggcaccgatgatgtcttcacacctgggccaagt
gacagccccagctcccagaggatacagcggtgcctcagtgacccaggcccccaccctgag
cctggggaaggagagcctttcatccccaaggggcagtag

DBGET integrated database retrieval system