KEGG   Equus asinus (ass): 106839455
Entry
106839455         CDS       T04645                                 

Gene name
CACNA1C
Definition
(RefSeq) calcium voltage-gated channel subunit alpha1 C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
eai  Equus asinus (ass)
Pathway
eai04010  MAPK signaling pathway
eai04020  Calcium signaling pathway
eai04022  cGMP-PKG signaling pathway
eai04024  cAMP signaling pathway
eai04260  Cardiac muscle contraction
eai04261  Adrenergic signaling in cardiomyocytes
eai04270  Vascular smooth muscle contraction
eai04713  Circadian entrainment
eai04720  Long-term potentiation
eai04723  Retrograde endocannabinoid signaling
eai04724  Glutamatergic synapse
eai04725  Cholinergic synapse
eai04726  Serotonergic synapse
eai04727  GABAergic synapse
eai04728  Dopaminergic synapse
eai04742  Taste transduction
eai04911  Insulin secretion
eai04912  GnRH signaling pathway
eai04921  Oxytocin signaling pathway
eai04924  Renin secretion
eai04925  Aldosterone synthesis and secretion
eai04927  Cortisol synthesis and secretion
eai04929  GnRH secretion
eai04930  Type II diabetes mellitus
eai04934  Cushing syndrome
eai04935  Growth hormone synthesis, secretion and action
eai05010  Alzheimer disease
eai05020  Prion disease
eai05022  Pathways of neurodegeneration - multiple diseases
eai05031  Amphetamine addiction
eai05410  Hypertrophic cardiomyopathy
eai05412  Arrhythmogenic right ventricular cardiomyopathy
eai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    106839455 (CACNA1C)
   04020 Calcium signaling pathway
    106839455 (CACNA1C)
   04024 cAMP signaling pathway
    106839455 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    106839455 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    106839455 (CACNA1C)
   04929 GnRH secretion
    106839455 (CACNA1C)
   04912 GnRH signaling pathway
    106839455 (CACNA1C)
   04921 Oxytocin signaling pathway
    106839455 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    106839455 (CACNA1C)
   04924 Renin secretion
    106839455 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    106839455 (CACNA1C)
   04927 Cortisol synthesis and secretion
    106839455 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    106839455 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    106839455 (CACNA1C)
   04270 Vascular smooth muscle contraction
    106839455 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    106839455 (CACNA1C)
   04727 GABAergic synapse
    106839455 (CACNA1C)
   04725 Cholinergic synapse
    106839455 (CACNA1C)
   04728 Dopaminergic synapse
    106839455 (CACNA1C)
   04726 Serotonergic synapse
    106839455 (CACNA1C)
   04720 Long-term potentiation
    106839455 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    106839455 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    106839455 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106839455 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106839455 (CACNA1C)
   05020 Prion disease
    106839455 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    106839455 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    106839455 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    106839455 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    106839455 (CACNA1C)
   05414 Dilated cardiomyopathy
    106839455 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    106839455 (CACNA1C)
   04934 Cushing syndrome
    106839455 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:eai04040]
    106839455 (CACNA1C)
Ion channels [BR:eai04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   106839455 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 106839455
NCBI-ProteinID: XP_014709678
LinkDB
Position
Un
AA seq 2009 aa
MVERTVEERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAIL
EQATKAEGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIA
LLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVC
KPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENE
DEGMDEEKPRNRGAPVGLLDQKKGKFAWFSHSTETHVSMPTSETESVNTENVAGGDIEGE
NCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNIFYWLVIFLVFLNTLTIASEHYN
QPHWLTEVQDTANKALLALFTTEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVE
TKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSL
LGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGM
LVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKK
QEVVEKPAVEEAKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYSNPETAGEED
EEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLIL
FFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRN
YFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIR
TIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQ
PRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFI
IYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQ
HQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMI
LKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPFMNAEENSRISITF
FRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIAL
NDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPC
GSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPE
AKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVR
TALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEY
FRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAV
CAASEDDIFRRAGGLFGNHVSYYQSDGRSAYPQTFTTQRPLHINKAGNSQGDTESPSHEK
LVDSTFTPSSYSSTGSNANINNANNTALGRFPRPTGYPSAVSTVEGHGLPLSPAIRVQEA
AWKLSSKRCPSRESQIAMVCQEEVSHEETYDVKMSEDPQRGSEPSLISTERLSYQDDEHR
QLTPPEEDKRDIRQSPKRGFLRSASLGRRASFHLECLKRQKSQGGDVSQKTVLPLHLVHH
QALAVAGLSPLLQRSRAPTTCPQPWATPSSQGWPPRPIPTLRLEGAESSEKLNSSFPSIH
CGSWSGEPTACGGGSSALRRARPVSLTVPSRAGAPGRQLHGSASSLVEAVLISEGLGQFA
QDPKFIEVTTQELADACDMTIEEMENAADNILSGGTQQSANGTLFPFVNCRDPGQDRAGG
EENETCAPALERGKSEGEPQDSRACGGSL
NT seq 6030 nt   +upstreamnt  +downstreamnt
atggtggaacggactgtggaggaacgagtggaatatctctttctcataatttttactgtg
gaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttacctccgc
aatggttggaatttactagactttataattgtggttgtagggcttttcagtgcaatttta
gaacaagccaccaaagccgaaggggccaacgctctgggcgggaagggggctggattcgac
gtgaaggcgctgcgggccttccgcgtgctgcgccccttgcggctggtgtccggagtccca
agtctccaggtggttctgaattccattatcaaggccatggtccccctgctgcacattgct
ctgctagtgctgtttgtcatcatcatctatgctatcatcggtctggagctcttcatggga
aagatgcacaagacctgctacaaccaggagggcattgcagatgttccagcagaagatgat
ccttctccttgcgctttggagacaggccacgggcggcagtgccagaatggcactgtgtgc
aagcccgggtgggacgggcccaagcatggcatcaccaactttgacaattttgccttcgcc
atgttgacagtgttccagtgcatcaccatggagggctggacagacgtgctgtactggatg
caggacgctatgggctatgagttaccctgggtgtattttgtcagtctggtcatctttgga
tcctttttcgttctaaatctggttctcggtgtgttgagcggagagttttccaaagagaga
gagaaggccaaggctcggggagatttccaaaagctgcgagagaagcaacagctggaagag
gacctcaaaggctacctggactggatcactcaggcagaagacatcgaccctgagaatgag
gacgaaggcatggatgaggagaaaccccgaaacagaggcgctccagtgggcttgcttgac
cagaagaaagggaagtttgcttggtttagtcactccacagaaacccatgtgagcatgccc
acaagtgagactgagtctgtcaacacggaaaacgtggctggaggtgacatcgagggagaa
aactgcggagccaggctggcccaccggatctccaagtctaagttcagccgctactggcgc
cggtggaatcggttctgcagaagaaagtgtcgtgcagcagtcaagtctaacattttctac
tggctggtgattttcctggtgttcctcaacacgctcaccatcgcctccgagcattacaac
cagccccactggctcacggaagtccaagatacggccaacaaggcactgctggccctgttc
accacggagatgctgctgaagatgtacagcctgggcctgcaagcctactttgtgtccctc
ttcaaccgctttgactgcttcatcgtgtgcgggggcatcctggagaccatcctggtggag
accaagatcatgtctccactgggcatctctgtgctgagatgtgtccggctactgaggata
tttaaaatcacaaggtactggaactccttaagcaacctggtggcatccttgctgaattct
gtgcgctccatcgcctccctgctgctactcctcttcctcttcatcatcatcttctccctc
ctggggatgcagctctttggaggaaagttcaactttgatgagatgcagacccggaggagc
acatttgataactttccccagtccctccttaccgtgtttcagatcctgaccggggaggac
tggaattcggtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatg
ttagtctgtatttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtg
ttcttggccattgctgtggacaacttggctgatgctgagagcctcacatctgcccaaaag
gaagaggaagaagagaaggagagaaagaagctggccaggactgccagcccagagaagaaa
caagaagtggtggagaagccagcagtagaggaggccaaggaggagaaaattgagctgaaa
tctattacagctgatggagagtccccacccacaaccaagatcaacatggatgacctccag
cccaatgaaaatgaggataagagtccctactccaacccagaaactgcaggagaagaagat
gaggaggagcctgagatgcctgttggcccccgcccccgcccactctctgagctgcacctt
aaggagaaggcagtgcccatgcccgaagccagtgcatttttcatcttcagccccaacaac
agattccgcctccagtgccaccgcatcgtcaatgacacgatcttcaccaacctgatcctc
ttcttcattctgctcagcagcatttccctggctgctgaggaccccgtccagcacacctcc
ttcaggaaccacattctgttttattttgatattgtttttactaccattttcaccattgaa
attgctctgaagatgactgcttacggggctttcctgcacaagggctctttttgccggaac
tacttcaacatcttggacctgctggtggtcagcgtatccctcatctcctttggcatccag
tccagtgcaatcaacgttgtgaagatcttgcgagttctccgagtcctcaggcctctgagg
gccatcaacagggccaaggggctaaagcacgtggttcagtgtgtgttcgtagccatccgg
accatcgggaacatcgtgattgtcaccacactgcttcagttcatgttcgcctgcattggg
gtccagctcttcaagggaaagctctacacctgttcagatagttccaaacagaccgaggca
gaatgcaagggtaactacatcacatacaaggacggggaagttgaccaccccatcatccag
ccccgcagctgggagaacagcaagtttgacttcgacaatgttctggcggccatgatggcc
ctcttcacggtctccacctttgaggggtggccagagctgctgtaccgctccatcgactcc
cacacggaagacaagggccccatctacaactaccgcgtggagatctccatctttttcatc
atctacatcatcatcattgccttcttcatgatgaacatcttcgtgggtttcgtcatcgtc
accttccaggagcagggggagcaggaatacaagaactgtgagctggacaagaaccagcga
cagtgtgtggaatacgccctcaaggcccggcccctgcggaggtacatccccaagaaccag
caccagtacaaagtgtggtacgtggtcaactccacctactttgagtacctgatgttcgtc
ctcatcctgctcaacaccatctgcttggccatgcagcactacggtcagagctgcctcttc
aaaatcgccatgaacatcctcaacatgctcttcacgggcctcttcacagtggagatgatc
ctgaagctcattgccttcaaacccaagggttactttagtgatccctggaatgtttttgac
ttcctcatcgttattggcagcataattgacgtcattctcagtgaaactaatccagctgaa
catacccaatgctctccctttatgaacgcagaggagaactcgcgcatctccatcaccttc
ttccgcctcttccgggtcatgcgcctggtgaagctgctgagccgaggggagggcatccgg
acgctgctctggaccttcatcaagtccttccaggcgctgccctacgtggcgcttctgata
gtgatgctgttcttcatctacgccgtgatcgggatgcaggtgtttggaaagattgccctg
aatgacaccacagagatcaaccgcaacaacaacttccagaccttcccccaggctgtgctg
ctcctcttcaggtgtgccacaggggaggcatggcaggacatcatgctggcctgcatgcca
gggaagaagtgtgccccggagtcggagcccagcaacagcacggaaggggaaacgccctgt
ggcagcagcttcgccgtcttctacttcatcagcttctacatgctctgtgccttcctgatc
atcaacctctttgtcgctgtcatcatggacaactttgactacctgacaagggactggtcc
atccttggtccccaccatctggatgaatttaaaagaatctgggcagagtatgaccctgaa
gccaagggtcggatcaaacacctagatgtggtcacgctgctccggcggattcagccccca
ctgggttttgggaagctgtgccctcaccgcgtggcttgcaaacgcctggtctccatgaac
atgcctctgaatagcgatgggacggtcatgttcaatgccaccctgtttgccctggtccgg
acagccctcaggatcaaaacagaagggaacctggaacaagccaatgaggagttgcgggcc
ataatcaagaagatctggaagcggaccagcatgaagctgctggaccaagtggtgccccct
gcaggtgatgacgaggtcacggttggcaagttttacgctactttcctgatccaagagtac
ttccgcaagttcaagaagcgcaaagagcagggccttgtgggcaagccctcccagaggaac
gccctgtccctgcaggctggcctgcgtaccctgcacgacatcgggcccgagatccgacgg
gccatctctggagatctgacagccgaggaggagctggacaaggccatgaaggaggccgtg
tgtgcggcctccgaggacgacatcttcaggagggctggtggcctgttcggtaaccacgtc
agctactaccaaagcgacggccggagcgcctacccccagaccttcaccacccagcgccca
ctgcacatcaacaaggcgggtaacagccaaggcgacactgagtcgccatcccacgagaaa
ctggtggactccactttcacccccagcagctactcgtccactggctccaacgccaacatc
aacaatgccaacaacactgccctgggccgcttcccccgccccaccggctaccccagcgcg
gtcagcaccgtggagggccatgggctccccctgtctcctgccatccgggtgcaggaggca
gcgtggaagctcagctctaagaggtgcccctcccgggagagccagatagccatggtgtgt
caggaggaggtctctcacgaggagacctatgacgtgaagatgagcgaagacccccagcgc
ggcagcgagccgagcctcatctccacggagaggctctcttatcaggatgatgagcatcga
cagctgacaccccccgaggaggacaagagggacatccggcaatctccaaagagaggtttc
ctccgctccgcctccctaggtcgtagggcctccttccacttggaatgtctgaagcgacag
aagagtcaagggggagacgtctctcagaagacagtcctgcccttgcatctggttcaccat
caggcattggcagtggcaggcctgagccccctcctccagagaagccgtgcccccaccacc
tgcccccagccctgggccacgcccagcagccaaggctggcccccgaggcccatccccacc
ctgcggctggagggggccgagtccagcgagaaactcaacagcagcttcccgtccatccac
tgcggctcctggtctggggagcccacggcctgtggtgggggcagcagcgccctccggaga
gcccggcctgtgtccctcacagtgcccagccgggccggggccccgggcaggcagctccac
ggcagtgccagcagtctggtggaagcggtcttgatttcagaaggactggggcagtttgct
caagatcccaagtttatcgaggtcacaacccaggagctggctgacgcctgcgacatgacg
atagaggagatggagaacgctgccgacaatatcctcagcgggggcacccagcagagcgcc
aacggcaccctcttcccttttgttaactgcagggacccagggcaggaccgagcagggggc
gaggagaacgagacctgcgcgccagccctggagcgtgggaagagcgagggggagccccag
gacagcagagcctgcggcggcagcctgtag

DBGET integrated database retrieval system