KEGG   Equus asinus (ass): 106840250Help
Entry
106840250         CDS       T04645                                 

Gene name
APOA5
Definition
(RefSeq) apolipoprotein A5
  KO
K09025  apolipoprotein A-V
Organism
eai  Equus asinus (ass)
Pathway
eai03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    106840250 (APOA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106840250 (APOA5)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Others
   106840250 (APOA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Apolipoprotein DUF885 ApoLp-III Exonuc_VII_L BcrAD_BadFG DUF883 ZnuA ACP_PD
Motif
Other DBs
NCBI-GeneID: 106840250
NCBI-ProteinID: XP_014711016
LinkDB All DBs
Position
Un
AA seq 373 aa AA seqDB search
MASKAAVLTWALALILAFSTARARKGFWDYFSQSSGDKGRVEQIQQQKLAWEPARLKDSR
EQDLNNMDKFLEKLGLLSGQGKVPPGLPHHPVGMWQRLQEELEEVRARLEPYMTEVHERV
GWNLEGLRRQLKPYTMELMEQVALRVQELQEQLRVVGEDTKTQLLGGVDEARGLLQELQS
RVAHHTDRVKALFHPYAERLVSGIGRHVQELHRSVAPHAAASPARLSRCVQVLSQKLTLK
AKALHARIQQNLDRLREELSAFAGAGASAGGAKKGADPDPQVLSQEVRQRLQAFRHDTFL
QIAAFTHAIDQETEEVQQQLAPPPPGHHAFAPEFLPGDSGKARSELQARLDDLWEDINYS
IHNDGLGGGDGEP
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcaaggctgcagttctgacctgggctctggccctcatcttagcgttttcaacg
gcccgggcacggaagggcttctgggactacttcagccagagcagcggcgataaaggcagg
gtggagcagatccagcagcagaagctggcgtgggagcccgccaggctgaaagacagccgt
gagcaagacctcaacaatatggacaagttcctggaaaagctgggccttctgagtggtcag
ggaaaggtgcctcctgggctcccacaccacccggtgggcatgtggcagcggctgcaggag
gagttggaagaggtgagggcccgcctggagccctacatgacagaggtacacgagcgcgtg
ggctggaacctggaagggctgcggcggcagctgaagccctataccatggagctgatggag
caggtggccctgcgcgtacaggagctgcaggagcagttgcgcgtggtcggagaggacacc
aagacccagctgctgggaggcgtggatgaggcgcggggcctgctgcaggaactgcagagc
cgcgtggcgcaccacaccgaccgcgtcaaggcgctcttccacccctacgccgagcgcctg
gtgtcgggcatcgggcgccacgtgcaggagctgcaccgcagcgtggccccgcacgccgcc
gccagcccggcgcgcctcagccgctgcgtgcaggtgctctcgcagaagctcacgctcaag
gccaaggccctgcacgcgcgcatccagcagaacctggaccggctacgcgaagagctcagc
gcctttgccggcgccggcgccagcgcaggcggcgcgaagaaaggggccgacccagacccc
caggttctgtcccaggaggtgcgccagcgactccaggctttccgccacgacaccttcctg
cagatcgccgccttcacccacgccattgaccaggagactgaggaggtccagcagcagctg
gcgccgcccccaccaggccaccacgccttcgccccagagttcctcccaggggacagcggc
aaggcccggagtgagctgcaggcccgtctcgacgacctgtgggaagacatcaactatagc
attcataacgatgggctcggtggtggcgacggggagccctga

DBGET integrated database retrieval system