KEGG   Equus asinus (ass): 106840623Help
Entry
106840623         CDS       T04645                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eai  Equus asinus (ass)
Pathway
eai00010  Glycolysis / Gluconeogenesis
eai00030  Pentose phosphate pathway
eai00051  Fructose and mannose metabolism
eai00052  Galactose metabolism
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai01230  Biosynthesis of amino acids
eai03018  RNA degradation
eai04152  AMPK signaling pathway
eai05230  Central carbon metabolism in cancer
Module
eai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106840623 (PFKP)
   00030 Pentose phosphate pathway
    106840623 (PFKP)
   00051 Fructose and mannose metabolism
    106840623 (PFKP)
   00052 Galactose metabolism
    106840623 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    106840623 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    106840623 (PFKP)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    106840623 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:eai01009]
    106840623 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eai03019]
    106840623 (PFKP)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     106840623 (PFKP)
Protein phosphatases and associated proteins [BR:eai01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106840623 (PFKP)
Messenger RNA biogenesis [BR:eai03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     106840623 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 106840623
NCBI-ProteinID: XP_014711749
LinkDB All DBs
Position
Un
AA seq 752 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARC
KAFRSREGRLQAARNLVQLGITNLCVIGGDGSLTGANIFRKEWSGLLEELAQNGQINKEE
VEKYSYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVIDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPACVVSLSGNQAVRLPLVKCVQMTQDVQKAMDERRFKDAVQLRGRSFENNLNTYKRLA
IKMPDTQIPKSNCNVGVINVGAPAAGMNAAVRAAVRVGIADGHKMFAVYDGFEGFAKGQI
KEIGWGDVGGWTGQGGSILGTKRTLPGKYLMEIAGQMRTHSINALLIIGGFEAYLGLLEL
SAAREKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDTCDRIKQSASGTKRRVF
IIETMGGYCGYLANMGGLAAGADAAYIFEEPFDIRDLQANVEHLTEKMKTTIQRGLVLRN
ESCSENYTTDFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKMSARAMQWIT
TKLKESQGKGRRFVSDDSICVLGISKRNLVFRPVAELKKETDFEHRIPKEQWWLKLRPLM
KILAKYKASFEVSDSEELEHVHHRGHEEPAAI
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccgctgtccgtgctgtcgtgcgcatggggatatacgtgggggccaaggtgtac
tttatctatgagggttaccagggcatggtggatggcggcagcaacatcgtggaagccgac
tgggagagcgtctcaagcatcctgcaagtgggtgggaccattatcggcagcgcccgttgc
aaggccttccgctcacgggagggccgcctgcaggctgctcggaacttggtccagctgggt
atcaccaacctgtgtgtgatcggaggggatggcagtctcactggggccaacatcttccgg
aaggagtggagcgggctgctggaagagctggcccagaatggccagatcaacaaagaggag
gtggagaagtactcgtacctcaacgtcgtggggatggtgggctccatcgacaacgacttc
tgcgggacggacatgaccatcggcaccgactcagctttgcacaggatcattgaggtcatc
gacgccatcatgaccaccgcccagagccaccagaggacgttcgttcttgaggtgatgggg
agacactgcgggtacctagccctggtgagcgccttggcctgcggggccgactgggtgttc
ctgcccgagtctccgccggaagagggctggcaggaaaacatgtgtgtcaaactctcggag
aaccgtgcccggaagaagagactgaatatcatcattgtggccgaaggagccattgatacc
caaaataaacccatcacctcggaacaaatcaaggagctcgtggtcacgcagctgggatat
gacacgcgggtgaccatactgggtcacgtgcagagaggagggacgccgtccgccttcgac
aggattttggccagccgcatgggcgtggaggccgtggtcgctcttctccaggccacccca
gagaccccggcctgcgtggtgtcgctgagcgggaaccaggccgtgcgcctgcccctggtg
aagtgcgtgcagatgacccaggacgtgcagaaggcgatggatgagaggaggtttaaggat
gctgtgcagctccgaggaaggagcttcgagaacaacctgaacacctacaagcggctcgcc
atcaagatgccggacacccagatcccaaagagcaactgtaacgtgggtgtcataaacgtg
ggcgcgccagccgccggcatgaatgccgccgtgcgcgcggccgtgcgggtgggcatcgcc
gacggccacaagatgttcgccgtctatgatggctttgaaggctttgccaaaggccagatc
aaagaaatcggctggggagatgtcggaggttggaccggccaaggaggctccattcttgga
acaaaacgcaccctccctgggaagtacttgatggagattgccgggcagatgcgcacccac
agcatcaatgcgttattgatcattggtgggtttgaggcctacttgggactgctggaactg
tcagctgcccgggagaagcacgaagagttctgtgtccctatggtcatggtccccgccacc
gtctccaacaacgtgcctggctccgatttcagcatcggtgcagacaccgccctgaacact
atcaccgacacatgtgaccgcatcaaacagtcggccagcgggaccaagcgccgtgtgttc
atcatcgagaccatgggaggctattgcggctacctggccaacatgggggggcttgctgca
ggagccgacgccgcctacatttttgaggagccctttgacatccgagacctgcaggccaac
gtggagcacctgacggagaagatgaagaccaccatccagaggggactggtgctcaggaac
gagagctgcagcgagaactacaccaccgacttcatctaccagctctactcggaagagggc
aaaggcgtgttcgactgcaggaagaacgtgctgggccacatgcagcaggggggagcgcct
tctcccttcgacagaaactttggaaccaaaatgtctgctagagccatgcaatggatcacc
acgaagctgaaggagtctcagggcaaaggaaggagatttgtaagtgatgattccatctgt
gtgctgggaataagcaaaagaaaccttgttttccgacctgtggcagagctcaagaaggaa
acggacttcgagcacaggattcctaaagagcagtggtggctgaagctgcggcctctcatg
aagatcctggccaagtacaaggccagcttcgaggtgtccgactcggaagagctggagcac
gtgcaccaccgcggccacgaggagccggccgccatctag

DBGET integrated database retrieval system