KEGG   Equus asinus (ass): 106841015
Entry
106841015         CDS       T04645                                 

Gene name
IL4, IL-4
Definition
(RefSeq) interleukin 4
  KO
K05430  interleukin 4
Organism
eai  Equus asinus (ass)
Pathway
eai04060  Cytokine-cytokine receptor interaction
eai04151  PI3K-Akt signaling pathway
eai04630  JAK-STAT signaling pathway
eai04640  Hematopoietic cell lineage
eai04657  IL-17 signaling pathway
eai04658  Th1 and Th2 cell differentiation
eai04659  Th17 cell differentiation
eai04660  T cell receptor signaling pathway
eai04664  Fc epsilon RI signaling pathway
eai04672  Intestinal immune network for IgA production
eai05140  Leishmaniasis
eai05200  Pathways in cancer
eai05310  Asthma
eai05320  Autoimmune thyroid disease
eai05321  Inflammatory bowel disease
eai05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106841015 (IL4)
   04151 PI3K-Akt signaling pathway
    106841015 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106841015 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106841015 (IL4)
   04660 T cell receptor signaling pathway
    106841015 (IL4)
   04658 Th1 and Th2 cell differentiation
    106841015 (IL4)
   04659 Th17 cell differentiation
    106841015 (IL4)
   04657 IL-17 signaling pathway
    106841015 (IL4)
   04664 Fc epsilon RI signaling pathway
    106841015 (IL4)
   04672 Intestinal immune network for IgA production
    106841015 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106841015 (IL4)
  09163 Immune disease
   05310 Asthma
    106841015 (IL4)
   05320 Autoimmune thyroid disease
    106841015 (IL4)
   05321 Inflammatory bowel disease
    106841015 (IL4)
   05330 Allograft rejection
    106841015 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    106841015 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eai04052]
    106841015 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106841015 (IL4)
Cytokines and growth factors [BR:eai04052]
 Cytokines
  Interleukins
   106841015 (IL4)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Cytokines
   106841015 (IL4)
SSDB
Motif
Pfam: IL4 Tugs
Other DBs
NCBI-GeneID: 106841015
NCBI-ProteinID: XP_014712257
LinkDB
Position
Un
AA seq 139 aa
MGLISQLIPALVCLLACTSNFIQGCKYDITLQEIIKTLNNLTDGKGKNSCMELTVADAFA
GPKNTDGKEICRAAKVLQQLYKRHDRSLIKECLSGLDRNLKGMANGTCCTVNEAKKSTLK
DFLERLKTIMKEKYSKCQS
NT seq 420 nt   +upstreamnt  +downstreamnt
atgggtctcatctcccaactgattccagctctggtctgcttactagcatgtaccagcaac
ttcatccagggatgcaaatacgacatcaccttacaagagatcatcaaaacgctgaacaac
ctcacagatggaaagggcaagaattcgtgcatggagctgactgtagcggatgcctttgct
ggcccaaagaacacagatggaaaggaaatctgcagggctgcaaaggtgcttcaacagctc
tataaaagacatgacaggtccttgatcaaagaatgcctgagcggactggacaggaacctc
aagggcatggcaaacgggacctgctgtactgtgaatgaagccaagaagagtacattgaaa
gactttttggaaaggctaaagacaatcatgaaagagaaatactcaaagtgtcaaagctga

DBGET integrated database retrieval system