KEGG   Equus asinus (ass): 106841027
Entry
106841027         CDS       T04645                                 

Gene name
IL3
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
eai  Equus asinus (ass)
Pathway
eai04060  Cytokine-cytokine receptor interaction
eai04151  PI3K-Akt signaling pathway
eai04210  Apoptosis
eai04630  JAK-STAT signaling pathway
eai04640  Hematopoietic cell lineage
eai04664  Fc epsilon RI signaling pathway
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05221  Acute myeloid leukemia
eai05310  Asthma
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    106841027 (IL3)
   04151 PI3K-Akt signaling pathway
    106841027 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    106841027 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    106841027 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    106841027 (IL3)
   04664 Fc epsilon RI signaling pathway
    106841027 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106841027 (IL3)
   05202 Transcriptional misregulation in cancer
    106841027 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    106841027 (IL3)
  09163 Immune disease
   05310 Asthma
    106841027 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:eai04052]
    106841027 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:eai00536]
    106841027 (IL3)
Cytokines and growth factors [BR:eai04052]
 Cytokines
  Interleukins
   106841027 (IL3)
Glycosaminoglycan binding proteins [BR:eai00536]
 Heparan sulfate / Haparin
  Cytokines
   106841027 (IL3)
SSDB
Motif
Pfam: IL3 PRESAN DUF5700
Other DBs
NCBI-GeneID: 106841027
NCBI-ProteinID: XP_014712283
LinkDB
Position
Un
AA seq 140 aa
MSSLPILHLLLLLFALHAPQAHGRPSPTLWENLIKEIMKDLNTTPLPPQDNLNPNEIQIL
GETTLLRPNLEAFCRAAPSFKEKVQIEKNLKELQSYLPTPMPMETDWEHSISIKKDSWGD
FQKKLIRYLETLENFLRNKH
NT seq 423 nt   +upstreamnt  +downstreamnt
atgagcagcctccccattctgcaccttctcctcctcctgttcgcactccatgctccccag
gcgcacgggaggccctccccaacactctgggaaaacctgatcaaagaaattatgaaggat
ctaaacacgacacctttgcctccacaagacaacttgaatccaaatgagatacagatcctc
ggggaaacgacccttctgaggccaaacctggaggcattctgcagagctgcccctagtttc
aaggagaaagtacaaattgagaaaaatcttaaggaattacagtcatacctgcctaccccc
atgcccatggagacagattgggaacactcaattagcatcaagaaggatagctggggtgat
ttccagaagaaattgataagatatctggaaacccttgagaactttctgagaaacaaacac
tga

DBGET integrated database retrieval system