KEGG   Equus asinus (ass): 106841140
Entry
106841140         CDS       T04645                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase 3
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00230  Purine metabolism
eai01100  Metabolic pathways
eai01522  Endocrine resistance
eai04015  Rap1 signaling pathway
eai04020  Calcium signaling pathway
eai04022  cGMP-PKG signaling pathway
eai04024  cAMP signaling pathway
eai04062  Chemokine signaling pathway
eai04072  Phospholipase D signaling pathway
eai04114  Oocyte meiosis
eai04211  Longevity regulating pathway
eai04213  Longevity regulating pathway - multiple species
eai04261  Adrenergic signaling in cardiomyocytes
eai04270  Vascular smooth muscle contraction
eai04371  Apelin signaling pathway
eai04540  Gap junction
eai04611  Platelet activation
eai04713  Circadian entrainment
eai04714  Thermogenesis
eai04723  Retrograde endocannabinoid signaling
eai04724  Glutamatergic synapse
eai04725  Cholinergic synapse
eai04727  GABAergic synapse
eai04740  Olfactory transduction
eai04750  Inflammatory mediator regulation of TRP channels
eai04911  Insulin secretion
eai04912  GnRH signaling pathway
eai04913  Ovarian steroidogenesis
eai04914  Progesterone-mediated oocyte maturation
eai04915  Estrogen signaling pathway
eai04916  Melanogenesis
eai04918  Thyroid hormone synthesis
eai04921  Oxytocin signaling pathway
eai04923  Regulation of lipolysis in adipocytes
eai04925  Aldosterone synthesis and secretion
eai04926  Relaxin signaling pathway
eai04927  Cortisol synthesis and secretion
eai04928  Parathyroid hormone synthesis, secretion and action
eai04934  Cushing syndrome
eai04935  Growth hormone synthesis, secretion and action
eai04962  Vasopressin-regulated water reabsorption
eai04970  Salivary secretion
eai04971  Gastric acid secretion
eai04972  Pancreatic secretion
eai04976  Bile secretion
eai05032  Morphine addiction
eai05163  Human cytomegalovirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05200  Pathways in cancer
eai05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    106841140 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    106841140 (ADCY3)
   04371 Apelin signaling pathway
    106841140 (ADCY3)
   04020 Calcium signaling pathway
    106841140 (ADCY3)
   04072 Phospholipase D signaling pathway
    106841140 (ADCY3)
   04024 cAMP signaling pathway
    106841140 (ADCY3)
   04022 cGMP-PKG signaling pathway
    106841140 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    106841140 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    106841140 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106841140 (ADCY3)
   04062 Chemokine signaling pathway
    106841140 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    106841140 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    106841140 (ADCY3)
   04912 GnRH signaling pathway
    106841140 (ADCY3)
   04913 Ovarian steroidogenesis
    106841140 (ADCY3)
   04915 Estrogen signaling pathway
    106841140 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    106841140 (ADCY3)
   04921 Oxytocin signaling pathway
    106841140 (ADCY3)
   04926 Relaxin signaling pathway
    106841140 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    106841140 (ADCY3)
   04918 Thyroid hormone synthesis
    106841140 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    106841140 (ADCY3)
   04916 Melanogenesis
    106841140 (ADCY3)
   04925 Aldosterone synthesis and secretion
    106841140 (ADCY3)
   04927 Cortisol synthesis and secretion
    106841140 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106841140 (ADCY3)
   04270 Vascular smooth muscle contraction
    106841140 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    106841140 (ADCY3)
   04971 Gastric acid secretion
    106841140 (ADCY3)
   04972 Pancreatic secretion
    106841140 (ADCY3)
   04976 Bile secretion
    106841140 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    106841140 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    106841140 (ADCY3)
   04727 GABAergic synapse
    106841140 (ADCY3)
   04725 Cholinergic synapse
    106841140 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    106841140 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    106841140 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    106841140 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    106841140 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    106841140 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106841140 (ADCY3)
   04714 Thermogenesis
    106841140 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106841140 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    106841140 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    106841140 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106841140 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106841140 (ADCY3)
   05163 Human cytomegalovirus infection
    106841140 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106841140 (ADCY3)
Enzymes [BR:eai01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     106841140 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA Peptidase_S49_N NCE101
Other DBs
NCBI-GeneID: 106841140
NCBI-ProteinID: XP_014712461
LinkDB
Position
Un
AA seq 1143 aa
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRRVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLVVAGIGLVLDLI
LFMLCKKGLLPDRVTRRVVPYLLWLLLTAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFF
ITLPLSLSPIVIISVVSCGVHTLVLGVTVAQQQQDGLKGMQLLREILANVFLYLCAIIVG
VMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPTSSKPSSPALIETKEPNGSVHT
SGSTSEEPEEQDAQADNPSFPNPRRRLRLQDLADRVVGASEDEHELNQLLSEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCAALVEILIDPWLMTN
YVTFVVGEVLLLVLTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPNNSTMGMEVDDGCVENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVTGAVAVINIYAWRPIFDEYDHKRFQEHELVALEKMQVFSTPGLNGTDRLPLVPSKYS
MTVMVFIMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVA
RHFLGSKKRDEELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDS
LLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFTSSNKEEKSDKERWQHLADLADFAL
AMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVMG
NIQVVEETQAILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKPAAFPNGSSVTLPHQVV
DNS
NT seq 3432 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgaccctgagtactccgctgagtactcggctgagtac
tctgtcagcctgccctctgaccctgaccgcagggtaggccggacccatgaaatctctgtc
cggaactcgggctcctgcctctgcctgcctcgcttcatgcggctgaccttcgtgcccgag
tccttggagaacctgtaccagacctacttcaagaggcagcgccacgagaccctgctggtg
ctggtggtcttcgcagccctcttcgactgctacgtggtggtcatgtgtgcagtggtcttc
tccagcgacaagctggctcccctggtcgtggccgggatcggcctggtgttggacctcatc
ctcttcatgctctgcaaaaaggggctgctccccgaccgggtcacccggagagtggtgccc
tacctgctgtggctgctgctaacagctcagatcttctcctacctgggcctgaacttctcc
cgcgcccacgcggccagcgacacggtgggctggcaggcgttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtcatcatctctgtggtctcctgtggcgtg
cacacgctcgtcctgggggtcactgtggcccagcaacagcaggatgggctgaaggggatg
cagttgctgagggagatcctggccaacgtcttcctctacctgtgtgccatcatcgtgggc
gtcatgtcctactacatggcggaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaggagcagagccagcagcaggagaaccttatgctt
tccatcctgcccaagcacgtggccgacgagatgctaaaggacatgaagaaggacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgccatgagaacgtcagcatc
ctctttgcggacatcgtgggcttcacccagctgtcgtctgcctgcagtgcccaggagctc
gtgaaactgctcaacgagctctttgcccgcttcgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgttactactgcatctgtggcctgccggactaccgg
gaggaccacgctgtctgctccatcctcatggggctcgccatggtggaggccatctcgtac
gtgcgggagaagacgaagactggggtggacatgcgtgtgggggtgcacacgggcactgtg
ctggggggcgtcctgggccagaagcgctggcagtacgacgtgtggtccactgacgtcact
gtggccaacaagatggaggctggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggagagtttgacgtggagccaggcgacgggggcagccgctgcgat
tacctagaagagaagggcatcgaaacctacctcatcatcgcgtccaagccggaagtgaag
aaaacagccacccaaaatggcctcaacggctcggccctcccaaatggagcaccaacttcc
tcaaagcccagctcccctgccctcattgagaccaaggaacccaatgggagtgtccacacc
agcggttccacatctgaggagcccgaagagcaagatgcccaggctgacaacccctccttc
cccaatcctcgccggaggctgcgccttcaggacctggccgatcgagtggtgggtgcctct
gaggacgagcatgaactcaaccagctgctcagtgaggcgctgctcgagcgcgagtctgcc
caggtagtgaagaagagaaacacctttcttctatccatgcggttcatggaccctgagatg
gaaacccgctactcggtggagaaggaaaagcagagtggggctgccttcagctgctcctgt
gttgtcctgctctgtgcggccctggtcgagatactcattgacccttggctaatgacaaac
tatgtgacttttgtggttggggaggttctgcttctggtcctgacaatctgctcgctggct
gctatctttccccgggcctttcctaagaagctcgtggccttctcaacatggatcgaccgg
acccgctgggccaggaacacctgggccatgttagccatcttcattttggttatggccaac
gttgtggacatgcttagctgtctccagtactacactggacccaacaacagcaccatgggg
atggaggtggacgatggctgcgtggagaaccccaagtattacaactatgtcgctgtgctg
tctctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacactcatg
ctgctcgtcacgggtgctgtggccgtcatcaacatctatgcctggcgccccatctttgat
gaatatgaccacaaacgttttcaggaacatgaattggttgccttagagaagatgcaagtg
ttttccacccctgggctcaatggcactgacaggctccccctggtgccttctaagtactcg
atgacagtgatggtcttcatcatgatgctgagcttttactacttctcccgacacgtggaa
aaactggcgcggacactgttcttgtggaagattgaggtccatgaccagaaggaacgtgtc
tatgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtggca
cgccatttcctggggtccaagaagagagatgaggagctgtacagccagtcttacgatgag
attggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagcatc
aataatggtggcatcgagtgtctgcgcttcctcaatgagatcatctcagactttgactct
ctcctggacaatcctaaattccgggtcatcaccaagatcaaaaccattggcagcacgtat
atggcagcttcaggagtcaccccagatgtcaacaccaacggctttaccagctccaacaag
gaggaaaagtcggacaaggagcgctggcagcacctggctgatctggctgactttgcatta
gccatgaaggatacacttacaaacatcaacaaccagtccttcaacaatttcatgctgcgt
ataggcatgaacaaaggaggggtactggctggggtcattggagcccggaaaccacactat
gacatctggggcaatacagtcaacgtagccagcaggatggagtccacaggggtcatgggc
aacattcaggtggtggaagaaacacaagccatccttcgagagtacggcttccgatttgtg
aggcgagggcccatctttgtgaaagggaagggggagctgctgacctttttcttgaaggga
cgtgacaagccagctgccttccctaacggctcctctgttacactgccccaccaggtggta
gacaactcctga

DBGET integrated database retrieval system