KEGG   Equus asinus (ass): 106842003Help
Entry
106842003         CDS       T04645                                 

Definition
(RefSeq) huntingtin
  KO
K04533  huntingtin
Organism
eai  Equus asinus (ass)
Pathway
eai05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:eai00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    106842003
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eai03019]
    106842003
   04131 Membrane trafficking [BR:eai04131]
    106842003
   03029 Mitochondrial biogenesis [BR:eai03029]
    106842003
Messenger RNA biogenesis [BR:eai03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106842003
Membrane trafficking [BR:eai04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    106842003
Mitochondrial biogenesis [BR:eai03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106842003
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3652
Motif
Other DBs
NCBI-GeneID: 106842003
NCBI-ProteinID: XP_014713804
LinkDB All DBs
Position
Un
AA seq 1901 aa AA seqDB search
AGNCVLSLHFPKVTLDLQNSTEKFGGFLRSALDVLSQILELATLQDIGKCVEEILGYLKS
CFSREPMMATVCVQQLLKTLFGTNLASQFDGLSSNPSKSQGRAQRLGSSSVRPGLYHYCF
MAPYTHFTQALADASLRNMVQAEQDHDTSGWFDVLQKVSTQLKTNLTSVTKNRADKNAIH
NHIRLFEPLVIKALKQYTTTTSVQLQKQVLDLLAQLVQLRVNYCLLDSDQVFIGFVLKQF
EYIEVGQFRESEAIIPNIFFFLVLLSYERYHSKQIIGIPKIIQLCDGIMASGRKAVTHAI
PALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKEN
EDKWKRLSRQIADIILPMLAKQQMHIDSHEALGVLNTLFEILAPSSLRPVDMLLRSMFVT
PDTMASVSTVQLWISGILAILRVLISQSTEDIVLSRIQELSFSPYLISCPIINRLRDGDS
NSTPEEQGEGRQVKNLPEETFSRFLLQLVGILLEDIVTKQLKVEMSEQQHTFYCQELGTL
LMCLIHIFKSGMFRRITAAASRLFTADGADSSFYGLESLNARVRSMVPTHPALVLLWCQI
LLLVSHTDYRWWAEVQQTPKRRSLSSTKSLCPQMSGEEEDSDLAAKLGMCNREIVRRGAL
ILFCDYVCQNLHDSEHLTWLIVNHVQDLISLSHEPPVQDFISAVHRNSAASGLFIQAIQS
RCENLSTPTTLKKTLQCLEGIHLSQSGAVLMLYVDKLLCTPLRVLARMVDTLACRRVEML
LAANLQSNMAQLPVEELNRIQEYLQNSGLAQRHQRLYSLLDRLRLATAPGSCGPSPPVTS
HPLDGDGPLALETVNPDKDWYIRLVKSQCWTRSDSALLEGAELVNRLPPGDMSAFMMNSE
FNLSLLAPCLGLGMREISGGQKSPLFEAARVVTLDRVTSMVQQLPPVHQVFQPFLPVEPS
TYWGKVNDLFGDAVLYRSLTTLARALAQYLLVFSKLPSHLHLPPEKEKDTVKFVVMTLEA
LSWHLMHEQIPLSLDLQAGLDCCCLALQLPGLWSVLSSPEMVTHACSLIHCVRFLLEAIV
VQPGDQLLSPERRTNTPKAAREDEVDSNTLNPKYITAACGMVAEMVESLPSVLALGHKRN
SNTPAFLTSVLKNIIISLARLPLVNSYTRVPPLVWKLGWAPKPGGDFGTAFPEIPVEFLQ
EKEVFKEFIYRINALGWTSRTQFEETWATLLGVLVTQPLVMEQEESPPEEDTERTQINVL
AVQAITSLVLSAMTVPVAGNPAVSCLEQQPRNKPLKALDTRFGRKLSIIRGIVEQEIQAM
VSKRENIATHHLYQAWDPVPSLSPATTGALISHDKLLLQINPERELGNMSYKLGQVSIHS
VWLGNSITPLREEEWDEEEEEEADVPAPSSAPTSPVNSRKHRAGVDIHSCSQFLLELYSR
WILPSSSARRTPIILISEVVRSLLVVSDLFTERSQFEMMYLTLTELRRVHPSEDEILVQY
LVPATCKAAAVLGMDKAVAEPVSRLLESTLRSSHLPSKIGALHGVLYVLECDLLDDTAKQ
LIPVISDYLLSNLKGVAHCVNIHSQQHVLVMCATAFYLIENYPLDVGPEFSASIIQMCGV
MLSGSEESTPSIIYHCVLRGLERLLLSEQLSRLDAESLVKLSVDRVNVHSPHRAMAALGL
MLTCMYTGKEKISPGRTSDPSPAAPDSESVIVAMERVSVLFDRIRKGFPCEARVVARILP
QFLDDFFPPQDVMNKVIGEFLSNQQPYPQFMATVVYKVFQTLHSTGQSSMVRDWVMLSLS
NFTQRTPVAMAVWSLSCFFVSASTSPWVSAVLPHVISRMGKLEQVDVNLFCLVATDFYRH
QIEEELDRRAFQSVFEVVAAPGNPYHQLLTCLRNVHKVSTC
NT seq 5707 nt NT seq  +upstreamnt  +downstreamnt
tgccggtaattgtgttctctccctccactttcccaaggtcaccttggatcttcagaacag
cactgaaaagtttgggggatttctgcgctctgccttggacgttctctctcagattctaga
attggcaacactgcaggacattgggaagtgtgttgaagagattctgggatatctgaaatc
ctgcttcagtcgagaaccaatgatggcaactgtttgtgttcaacagttgttgaagactct
ctttgggacaaacttagcctcccagtttgatggcttgtcttccaaccccagcaagtctca
aggccgagcacagcgccttggctcttccagcgtgaggccaggcttgtaccactactgctt
catggctccatacacccacttcacccaggccttagccgacgccagcctgaggaacatggt
gcaggcggagcaggatcacgacacctcagggtggtttgatgtactccagaaagtgtctac
ccaactgaagacaaacctcacgagcgtcacaaagaaccgtgcagataagaatgctattca
taatcacattcgtttatttgagcctcttgttataaaagctttaaaacagtacactacaac
aacatctgtacagttacagaagcaggttttggatttactggcacagctggttcagttacg
ggttaattactgtcttctggattcagatcaggtgtttattggatttgtgctgaagcagtt
tgaatacattgaagtgggccagttcagggaatcagaggcaattatcccaaacatcttttt
cttcctggtattactatcttatgaacgctatcattcaaaacagatcatcggaattcccaa
aatcattcagctctgtgatggcatcatggccagtgggaggaaggctgtgacacatgccat
accagctctgcagcccatagtccatgacctcttcgtattaagaggaaccaataaagctga
tgcaggaaaagagcttgaaacccaaaaagaggtggtggtgtcaatgttactgagactcat
ccagtaccatcaggtgttggagatgtttattctagtcttgcagcagtgccacaaggagaa
cgaagacaagtggaaacggctgtctcgacagatagccgacatcatcctcccgatgttagc
caaacaacagatgcacattgattctcacgaggcccttggagtgctgaacactttatttga
gatcctggccccttcctccctgcgccccgtggacatgctgttacggagtatgtttgtcac
tccagatacaatggcatctgtcagcactgttcaactgtggatatcaggaatcctagccat
tttgagagttctaatttcccagtcaactgaagatattgtcctttctcgtattcaggagct
ttccttctctccatatttaatctcctgtccaataattaatagattaagagatggggacag
taattcaacaccagaagaacaaggtgaagggagacaagtgaagaatttaccagaagaaac
attttcaaggtttctactacaactggttggcattcttttagaggacattgttacaaaaca
gctaaaagtggaaatgagtgagcagcaacataccttctattgccaagaactaggcacgct
gctgatgtgtctgatccacatcttcaagtctggaatgttccggagaatcacagcagctgc
ctctagactcttcactgctgacggcgccgatagcagtttctacggcctggagagcttgaa
tgcgcgggtgcgctccatggtccccacacacccggccctggtgcttctctggtgtcagat
cctgctgcttgtcagccacactgactaccgctggtgggcagaggtgcagcagacccccaa
acgacgcagtctgtccagcacaaagtccctctgtccccagatgtctggagaagaggagga
ttccgatttggcagccaaacttggaatgtgcaatagagaaatagtacgaagaggagctct
cattctcttctgcgattatgtttgccagaacctacatgactcagagcacttaacatggct
cattgtgaatcatgttcaagatctgatcagtctgtcccatgagcctcccgtgcaggattt
tattagtgcggttcatcggaattctgctgccagtggccttttcatccaggccattcagtc
tcgttgtgaaaatctttccactcccaccactctgaagaaaactcttcagtgtttggaagg
gatccacctcagccagtcgggtgctgtgctgatgctgtatgtggacaagcttttgtgtac
tccgctccgtgtgctggctcgcatggttgacacccttgcttgtcgccgggtagaaatgct
tttggctgcaaatttacagagcaatatggcccagctgccagtggaagaactcaacagaat
ccaggaataccttcagaacagtgggttagcccagagacaccaaaggctctactccctgct
ggacaggcttcgtctcgccactgcaccaggatcatgtggcccttctcctccggtcacatc
ccacccgctggacggggatggacccctggctctggagacagttaatccagacaaagactg
gtacatacgcctagtcaaatcccagtgctggactaggtcagattccgcactgctggaagg
ggcagagctggtgaatcggcttcctcccggggacatgagtgcattcatgatgaactcgga
gttcaacttaagcctcttagccccatgcttgggcctgggcatgcgtgaaatttctggagg
ccagaagagtcccctatttgaagctgctcgagtggtaactctggaccgtgtgaccagcat
ggttcagcagctgcctcctgtccatcaagttttccaaccattcctacccgtggagcccag
tacctactggggcaaagtgaatgatctatttggggatgctgtattgtatcggtctctgac
cactctggcccgagcactggcccagtacctgctggtgttctccaaactgcccagccactt
gcaccttcctcctgagaaggagaaggacactgtgaagtttgtggtcatgacactcgaggc
cctgtcatggcatttgatgcacgagcagatcccgctgagtctggatctccaggcgggcct
ggactgctgctgcctggctctgcagctgcctggcctctggagtgtgctctcctccccaga
gatggtgacccacgcctgctccctcattcactgtgtccggttcctcctggaagccattgt
ggtgcagcctggggaccagcttcttagtccagaaagaaggacgaacaccccaaaggctgc
cagagaggacgaagtagattcaaatacactaaaccctaagtatatcactgcagcctgtgg
gatggtggcagaaatggtggagtctttgccatccgtgttggccttgggtcataaaaggaa
tagcaacactccagcgtttctcacgtcggtgctcaagaacatcatcatcagcctggctcg
cttacccctcgtcaacagctacacacgcgtccctcccctggtgtggaaacttggatgggc
acccaaaccaggaggggattttggcacagcgttccccgagatccccgtggagttcctcca
ggaaaaggaagtcttcaaagagttcatctaccgcatcaatgcgctagggtggaccagccg
tacccagtttgaggaaacgtgggccaccctccttggtgtcctggtgactcagccactcgt
gatggaacaggaggagagcccaccagaagaagatacagagaggactcagatcaatgtcct
ggccgtgcaggccatcacctccctggtgctgagtgcgatgactgtgcccgtggccggcaa
cccagctgtgagctgcttggagcagcagccccggaacaagcccctgaaggctctcgacac
caggtttgggaggaagttgagcattatcagaggaattgtagagcaggaaattcaagctat
ggtttcaaagagagagaatattgccactcatcatttatatcaagcgtgggaccctgtccc
ttctctgtctccagctactacaggtgccctcatcagccatgacaaacttctgctgcagat
caaccccgagcgggagctggggaacatgagctataagctcggccaggtgtcaatccactc
tgtgtggctggggaacagcatcacacccctgagagaggaggagtgggacgaggaggagga
ggaggaggctgatgtccctgcaccttcgtcagcacccacatctccagtcaactccaggaa
acaccgggctggggttgatatccactcctgttcgcagtttttgcttgaattgtacagtcg
ctggatcctgccgtccagttcagccagaaggacccccattatcctgatcagtgaagtggt
tcgatctcttctggtggtctcagacttgttcactgagcgcagccagtttgagatgatgta
cctgacgctgacagagctgcggagggtgcacccttcagaagacgagattctcgttcagta
cctggtgcctgccacctgtaaggcggctgccgtcctcggaatggacaaggccgtggcaga
gccagtcagccgcctgctggagagcacgctcaggagcagccatctgcccagcaagattgg
ggccctacatggcgttctgtacgtgctggagtgtgacctcctggacgacaccgcaaaaca
gctcatcccagtcatcagcgactatctcctctccaacctcaaaggagtagcccactgtgt
gaacattcacagccaacagcatgtgctggtgatgtgtgctaccgccttctacctgattga
gaactatcctctggatgtagggccagaattctctgcatcaataatacagatgtgtggggt
gatgctgtctggaagtgaggagtccactccatccatcatttaccactgcgtcctgagggg
cctggagcgcctcctgctctccgagcagctctcccggctggacgcagaatccctggtcaa
gctgagtgtggacagagtgaatgtacacagcccacaccgggccatggcggccctgggcct
gatgctcacctgcatgtacacaggaaaggagaaaatcagtccaggcagaacctcggaccc
cagccctgctgccccagacagcgagtcagtgattgtggctatggaacgcgtgtctgttct
tttcgataggatcaggaaagggtttccttgtgaagccagagtggtggcgcgaatccttcc
tcagtttttagatgacttcttcccgccccaggacgtcatgaacaaagtcattggagagtt
tctgtccaaccagcagccatacccgcagttcatggccactgtagtatacaaggttttcca
gactttgcatagcacggggcagtcgtccatggtccgggactgggtcatgctgtctctctc
caacttcacgcagaggaccccggttgcaatggccgtgtggagtctctcctgcttcttcgt
cagtgcttccaccagcccgtgggtttcagcagtccttccacacgtcatcagcaggatggg
caagctggagcaagtggacgttaacctcttctgcctggtggccacagacttttacagaca
ccaaatagaggaggagctggaccgcagggcctttcagtccgtgtttgaggtggttgcggc
accaggaaacccgtaccaccaactgctgacttgtttgcggaatgtccacaaggtctccac
gtgctga

DBGET integrated database retrieval system