KEGG   Equus asinus (ass): 106842035Help
Entry
106842035         CDS       T04645                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
eai  Equus asinus (ass)
Pathway
eai04068  FoxO signaling pathway
eai04146  Peroxisome
eai04211  Longevity regulating pathway
eai04213  Longevity regulating pathway - multiple species
eai05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106842035 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106842035 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    106842035 (SOD2)
   04213 Longevity regulating pathway - multiple species
    106842035 (SOD2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    106842035 (SOD2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     106842035 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 106842035
NCBI-ProteinID: XP_014713832
LinkDB All DBs
Position
Un
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGSLGSRQKHSLPDLQYDYGALEPYINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHTIFWTNLSPNGGGEPKGELLDA
IKRDFGSFDKFKEKLTAVSAGVQGSGWGWLGFNKDQGRLQIVACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcggcgtgcagcacgagcaggaagctggtgccagctctggggtctctg
gggtcccggcagaagcacagcctccccgacttgcagtatgattatggcgctctggagccc
tacatcaacgcccagatcatgcagctgcaccacagcaagcaccacgcggcctatgtgaac
aacctgaacgtcaccgaggagaagtaccaggaggcgctggccaagggggacgtgacagct
cagattgctctgcagcctgcactcaagttcaatggtggaggccatatcaatcataccatt
ttctggacaaacctgagccccaatggcgggggagagcccaaaggggaattgctggacgcc
atcaaacgtgactttggttccttcgacaaatttaaagagaagttgaccgctgtatcggct
ggtgtccaaggctcgggttggggttggcttggtttcaataaggaccagggacgcctccag
attgttgcctgtcctaaccaggatcccctgcagggaacaacaggtcttattcccctgctg
gggattgacgtgtgggagcacgcttattaccttcagtataaaaatgtcaggcctgattat
ctgaaagccatttggaatgtgatcaactgggagaatgtatctgagagatacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system