KEGG   Equus asinus (ass): 106842112Help
Entry
106842112         CDS       T04645                                 

Gene name
SORBS1
Definition
(RefSeq) sorbin and SH3 domain containing 1
  KO
K06086  sorbin and SH3 domain containing 1
Organism
eai  Equus asinus (ass)
Pathway
eai03320  PPAR signaling pathway
eai04520  Adherens junction
eai04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:eai00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    106842112 (SORBS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106842112 (SORBS1)
   03320 PPAR signaling pathway
    106842112 (SORBS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SH3_9 SH3_1 SH3_2 Sorb
Motif
Other DBs
NCBI-GeneID: 106842112
NCBI-ProteinID: XP_014713925
LinkDB All DBs
Position
Un
AA seq 1291 aa AA seqDB search
MSSECDVGASKAVVNGLAPGSNGQDKATADPLRARSISAVKIIPVKTVRNSSGLVLPPDM
DPTKICTGKGAVTLRASSSYREIPSSGPVSPQETPKHESKPVLESENSSADEWRLSSNAD
ANGNAQPSSLAAKGYRSVHPNLPSDKPQDATSSSPAQPEVIVVPLYLVNTDRGQEGTTRP
PASLGPLGPPVPATAPAGSPLTLPTLDDFIPPRLQRRPHHSQPASTPGSFPPVSQTPPSF
SPPPPLVPPVPEGLHRVSEPDLTGAVSSTDSSPLLNEVSSSHVGTDSQTFAPVSKPTSAY
PSTTIVNPTIVLLQHNREQQKRLSSLSDPVSERRVGEQASVPTQEKATSPGRATEKKAKD
DSRRVVKSAQDLSDVSMDEVGIPLRNTERSKDWYKTMFKQIHKLNRDTPEENPYFPTYKF
PELPEIQQNSEEDNPYTPTYQFPASTPSPKSEDDDSDLYSPRYSFSEDTKSPLSVPRSKS
EMSYIDGEKVVKRSATLPLPARSSSLKSSPERNDWEPPDKKVDTRKYRAEPKSIYEYQPG
KSSVLTNEKMSRDISPEEIDLKNEPWYKFFSELEFGKPPPKKIWDYTPGDCSILPREDRK
TNLEKDLNLCQTELEADLEKMETLNKTPSAELAQSSAVSPTPEISSEPPGYIYSSNFHAV
KRESDGAPGDLSSLENERQIYKSVLEGGDIPLQGLSGLKRPSSSASTKDSESPRHFIPAD
YLESTEEFIRRRHDDKEKLLADQRRLKREQEEADIAARRHTGVIPTHHQFITNERFGDLL
NIDDTAKRKSGSEMRPARAKFDFKAQTLKELPLQKGDIVYIYKQIDQNWYEGEHHGRVGI
FPRTYIELLPPAEKAQPKKLTPVQVLEYGEAIAKFNFNGDTQVEMSFRKGERIMLLRQVD
ENWYEGRIPGTSRQGIFPITYVDVIKRPLVKNPVDYIDLPFSSSPSRSATASPQFPSHSK
LIMRAPSSLPYPHRALSPEMHAVTSEWISLTVGVPGRRPLALTPPLPPLPEASIYDTDHL
ALMARPNPSLSLSLPHSSWSDRSTPRSIASPLALPAPHKAYSLAPSTQASLHVNGDSGIH
MPTSGVRQDSFSQPPLGSSDRVISELSNAFSSQGKRQPWREESRWYERKAEREAGERCPG
GPKISKKSCLKPSDVVRCLSTEQRLSDLHTPEESRPSKPLGSPFPGREAEQTELHRGGEQ
AERKAARSGVSQQPQAQQRRVTPDRSQTSQDLLSYQALYSYIPQNDDELELRDGDIVDVM
EKCDDGWFVGTSRRTRQFGTFPGNYVKPLYL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgaatgtgacgttggtgcttctaaagccgtggtgaatgggttggccccaggc
agcaatgggcaggacaaagcaactgccgaccctttacgtgcacgctctatttctgctgtt
aaaataattcctgtgaagacagtgagaaactcttcaggcctagtactccctccagacatg
gatcctacaaaaatctgcactgggaaaggagcagtgactctccgggcctcgtcttcttac
agggaaatcccgagcagtggccccgtgagtcctcaggaaaccccgaaacatgaaagcaaa
ccagttctggagtcagagaattcctcagcagatgaatggaggctttcttctaacgctgat
gccaatggaaacgcccaaccctcttcacttgctgccaagggctacagaagtgtgcatccc
aaccttccttccgacaagccccaggatgccacttcctccagcccagcccagcctgaggta
atagttgtccctctctacctggttaatactgacagagggcaagaaggcactaccagacct
ccagcatctctggggccacttggccccccagtcccggcgaccgcccctgccggctcacct
ctgaccttgccgactctagatgatttcattccccctcgtctgcagaggcggccccaccac
agccagccagccagcactcctggctccttcccccccgttagccagacaccaccatccttc
tcaccaccacctccgctggtccctccagtaccggagggcctccacagagtctcggagcct
gacctcacgggagctgtttcaagtaccgattcaagtcctctactaaatgaagtttcttca
tcccatgttggaactgattcccaaacctttgcaccagttagcaagccaacatctgcctac
ccctccacgacaattgtcaatcccactattgtgctcttgcaacacaatcgagaacagcag
aaaagactcagtagcctttcagatcctgtctcagaaagaagagtgggagagcaggcctcg
gtaccaacccaggaaaaagccacctcacctggcagggctactgaaaaaaaggcaaaggat
gacagtcggcgagtggtgaagagcgctcaggacctgagcgatgtttccatggatgaagtg
ggcattccactccggaacaccgagagatcaaaagactggtacaagactatgtttaaacag
atccacaaactgaacagagacactcctgaagaaaacccttatttccctacgtacaaattc
cctgaacttcctgaaatccagcaaaattctgaagaggacaatccttacactcctacctac
cagtttcctgcatctactcctagtcctaaatctgaagatgatgattcagatctgtactct
cctcgatactccttttctgaagacacaaaatctcccctttctgtgcctcgctcaaaaagt
gagatgagctacattgatggtgagaaggtagttaagaggtcggccacacttcccctcccg
gcccgctcttcctcactaaaatcaagcccagaaagaaacgactgggagcccccagataag
aaagtggatacaagaaaataccgtgcagagcccaaaagcatttatgaatatcagcctggc
aagtcctccgttctgaccaacgaaaagatgagtcgggatataagcccagaagagatagat
ttaaagaatgaaccttggtataaattcttttcggaattggagtttgggaaaccgcctccc
aaaaagatatgggattatactcctggagactgctctatccttcctagagaggatagaaag
actaacctagaaaaagatctcaacctctgccagacagagttagaggcagatttagaaaaa
atggagacgcttaataaaacacccagtgcagagctggcccagagctcagcagtcagcccc
actccggaaatttcttcagagcctcctggatatatatattcttccaacttccacgcagtg
aagagggaatcagatggggctcctggagatctctctagcttggagaacgagaggcagatc
tataaaagcgtcctggaaggtggagacatccctctccagggcctgagtgggctcaagcga
ccatccagctcggcctccactaaagattcagaatcaccaagacattttataccagctgat
tacttggaatccacagaagaatttattcgaaggcgtcatgatgataaagagaaactttta
gcggaccagagacgacttaaacgagagcaagaagaggccgatattgcagctcgacgccac
acgggcgtcattccgacgcaccatcagtttatcactaatgagcgctttggggacctcctc
aatatagacgatacggcaaaaaggaaatctgggtcagagatgagacccgccagagctaaa
tttgactttaaagctcagacactaaaggagcttcctctgcagaagggagacatcgtttac
atttacaagcagattgatcagaactggtatgagggagagcaccacggccgcgtgggcatc
ttcccgcgcacctacattgagctgcttcctcctgctgagaaggctcagcccaaaaagttg
acaccagtgcaggttttggaatatggagaagctattgctaagtttaactttaatggtgac
acacaagtagaaatgtccttcaggaagggtgagaggatcatgctgcttcgacaggtggat
gagaactggtacgaagggaggatcccagggacgtcccggcaaggcatcttccccatcacc
tatgtggacgtgatcaaaaggccactggtgaaaaaccctgtggattacatcgacctgcct
ttctcctcttccccaagtcgtagtgccactgcaagcccacagtttcccagtcacagcaag
cttatcatgcgagccccctcatctctgccttacccccaccgagccctgtcccctgagatg
catgccgtcacctctgagtggatctcgctgactgtaggggtcccaggcaggcgtcctctg
gccctgaccccacccttgcctcctttgccagaggcttctatctatgacactgaccacctc
gccttgatggcaaggcccaatccctccctgtccctcagcctaccccactcgagttggtca
gatcgttccaccccacgttcgatagcttccccactggcccttcccgccccccacaaagcc
tactccctggcacccagtactcaggcctcccttcatgtcaatggagacagtggtatccat
atgccaacttcaggtgtccgccaggatagcttctcccagccaccgcttgggagctctgat
agggtcatctcagagcttagcaatgcctttagcagccagggtaagcggcagccatggcga
gaagagagcagatggtatgagaggaaagcagagagggaggcaggtgagagatgccctggt
ggacccaagatctctaagaagagctgcttgaaaccttcagacgtggtcaggtgcctgagc
actgaacagagactctcagatctccacaccccagaggagagccggcccagcaagcccctg
ggtagcccttttccgggaagggaggctgagcagacagagctgcatagaggtggcgagcag
gctgagaggaaggctgctcggagtggtgtgagccagcaacctcaagcccagcagcgaaga
gtcaccccagacaggagtcaaacctcacaagatttacttagctaccaagcactgtatagc
tatataccacagaacgatgatgaattggaactccgagatggagatattgttgatgtgatg
gaaaaatgtgatgatggatggtttgttggtacttcaagaaggacaaggcagtttggtact
tttccaggcaactatgtaaagcctttgtatctataa

DBGET integrated database retrieval system