KEGG   Equus asinus (ass): 106842261Help
Entry
106842261         CDS       T04645                                 

Gene name
ALDH2
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00010  Glycolysis / Gluconeogenesis
eai00053  Ascorbate and aldarate metabolism
eai00071  Fatty acid degradation
eai00280  Valine, leucine and isoleucine degradation
eai00310  Lysine degradation
eai00330  Arginine and proline metabolism
eai00340  Histidine metabolism
eai00380  Tryptophan metabolism
eai00410  beta-Alanine metabolism
eai00561  Glycerolipid metabolism
eai00620  Pyruvate metabolism
eai01100  Metabolic pathways
Module
eai_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106842261 (ALDH2)
   00053 Ascorbate and aldarate metabolism
    106842261 (ALDH2)
   00620 Pyruvate metabolism
    106842261 (ALDH2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106842261 (ALDH2)
   00561 Glycerolipid metabolism
    106842261 (ALDH2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106842261 (ALDH2)
   00310 Lysine degradation
    106842261 (ALDH2)
   00330 Arginine and proline metabolism
    106842261 (ALDH2)
   00340 Histidine metabolism
    106842261 (ALDH2)
   00380 Tryptophan metabolism
    106842261 (ALDH2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106842261 (ALDH2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106842261 (ALDH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh HetR_C
Motif
Other DBs
NCBI-GeneID: 106842261
NCBI-ProteinID: XP_014714145
LinkDB All DBs
Position
Un
AA seq 521 aa AA seqDB search
MLRAAALAAAGLGPRLGRRLLSAAATQAVPAPNQQPEVFYNQIFINNEWHDAVSKKTFPT
VNPSTGEVICQVAAGDKEDVDRAVKAARAAFQLGSPWRRMDASDRGRLLNRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLTKEAGFPPGVVN
VVPGFGPTAGAAIASHEDVDKVAFTGSTEVGHLIQVAAGRSNLKKVTLELGGKSPNIIMS
DADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAQSRVVGNPFDSQT
EQGPQVDETQFNKVLGYIKSGKEEGAKLLCGGGAAADRGYFIQPTVFGDVQDGMTIAKEE
IFGPVMQILKFKTIEEVVGRANNSKYGLAAAVFTKDLDKANYLSQALQAGTVWINCYDVF
GAQSPFGGYKMSGNGRELGEYGLQAYTEVKTVTIKVPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgcgccgctgccctcgccgccgcaggcctcgggccccgcctgggccgccgcctc
ctctcggccgccgccacccaggccgtgccggcccccaaccagcagcccgaggtcttctac
aaccagatcttcataaacaatgagtggcacgacgctgtcagcaagaaaacattccccacc
gtcaatccgtctactggggaagtcatctgtcaggtagctgcaggcgacaaggaagatgtg
gacagggcagtgaaggctgcccgggctgcctttcagctgggctcgccctggcgccgcatg
gatgcatctgacaggggccggctgctgaaccgcttggctgatctgattgagcgggaccgg
acctacctggcagccttggagaccctggataatggcaagccctacgtcatctcttacctg
gtggatttggacatggtcctcaaatgtctccgttattatgctggctgggccgataagtac
catgggaaaaccattcccatcgatggggacttcttcagctacacccgccatgaacctgtg
ggggtgtgtgggcagatcattccgtggaacttcccactcttgatgcaagcatggaaactg
ggcccagccttggcgactggaaacgtggttgtgatgaaggtggccgagcagactccactc
actgccctctatgtggccaacttgactaaggaggctggctttccccctggcgtggtcaat
gttgttcctggatttggccccacggctggggctgccattgcctcccatgaggatgtggac
aaagtagctttcacaggctccactgaggttggccacctaatccaggttgctgcagggagg
agtaacctcaagaaagtgaccctggagctgggaggaaaaagccccaacatcatcatgtca
gatgctgacatggactgggcggtggagcaggcccacttcgccctgttcttcaaccagggc
cagtgctgctgtgcaggctcccggacctttgtgcaggaggatgtttacgctgagtttgtg
gagcgcagcgttgcccgggcccagtctcgtgtggttgggaacccctttgacagccagacc
gagcaggggccacaggtggatgaaactcagtttaataaggtccttggctatatcaaatct
gggaaggaagagggggcgaagctgctgtgtggtggaggggcagctgctgaccgtggctac
ttcatccagcccactgtgttcggagatgtgcaagatggcatgacaatcgcaaaggaggag
atcttcgggccagtgatgcagatcctgaagttcaagaccatagaggaagtcgtcgggaga
gccaacaattccaagtatgggctggccgcagctgtcttcacaaaggacttggacaaagcc
aattatctgtcccaagccctccaggctggcactgtgtggatcaactgctatgatgtgttt
ggggcccagtcaccatttggtggctacaagatgtctgggaacggccgggagctgggagag
tatggcctgcaggcatacaccgaggtgaaaactgtcacaatcaaagttcctcagaagaac
tcataa

DBGET integrated database retrieval system