KEGG   Equus asinus (ass): 106842570Help
Entry
106842570         CDS       T04645                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00052  Galactose metabolism
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106842570 (MGAM2)
   00500 Starch and sucrose metabolism
    106842570 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106842570 (MGAM2)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106842570 (MGAM2)
    3.2.1.20  alpha-glucosidase
     106842570 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 106842570
NCBI-ProteinID: XP_014714676
LinkDB All DBs
Position
Un
AA seq 2432 aa AA seqDB search
MARKLTVLEVLLIVFIIIILVLDILLLLLVLENPSDTENLPVCPEIPESERIDCAPGQMV
TEAVCRWQHKCCWKPGSDADVPTCFFPRNWGYNVSNDYKNTSTGFTAQLKRLSSPSLFGY
DIVDTLFTAEYQTANRFHFKITDFNNMRYEVPHENIQLFNETVDTSNLSYHIEVTHIPFS
IKIMRTSNKRVLLDTSIGPLLFAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWETWPI
FTRDATPTEGMNNLYGAHTFFLCLEDTSGSSFGVFLLNSNAMEVTLQPAPAITYRTTGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPSYWSLGFQLSRRNYGGINGLKEVVDRNRAAGI
PYDVQYSDIDYMDGKKDFTIDEEVFPGLSNFIKDLHSNGMKYVIAMNPGISNNSDYLPYV
NGTKKRVWILDDNGFVTGQGYPGWTVFPDYSNPICTEWWTEEFSEFHKTLEFDGVWIEMD
EVSSFLQGSDHECESNNLNFPPFTPRVLDHFLFARTLCMDTVFHSGLHYDVHSLYGYSMA
RATDSAMENVFPNKRNFILSRSTFAGSGKFVAHWLGDNAATWDDLRWSIPSILEFNLFGI
PLVGANICGYREDVSEELCRRWMQLGAFYPLSRNHNGPDFRDQDPAAFGENSQLLNSSRH
YLNIRYTLLPYLYSLFYRAHTLGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLY
EGVTQVKAYIPDAIWYNYETGVAIQWRKQLVEMLLSDEKIGLHLRGGYIFPTQQPNTTTE
NSRKNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKNYILYDFSVTSNRLQAKIINDNY
MDPNNLTFTNITILGMDKQPTNFTVLFNNAATPIPNVVYSASTKVVSITDLEGLVLGREF
SIGWNLPVSDLEKFNCYPEDPSASEESCRQRGCLWEHTTTPGVPTCYYDTIPSYAASNIQ
YLPTGITTDLALLTAPESVGAAAPPPPSSRGAPPPPAAAAATSDDLSAKIDFLQLSVIYH
TENMLQFKIYDPRNKRYEVPVPLNTPPSPVGSPENRLYDVRIQNNPFGIQIRRKSSNTVI
WDSQLPGFTFNDMFLSISTRLPSEYIYGFGETEHTTFKRNMSWHMWGMFARDEPPAYKKN
SYSVHPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMFLGPTPELV
TQQYTELVGRPAMIPYWALGFQLSRYGYQNDTEISNLYDAMMAAQIPYDVQHVDIDYMDR
KLDFTLSSSFQNLGLLIEQMKKDGMRFILILDPAISGNETQYLTFTRGQENNVFIKWPDN
SDIVWGKVWPDLPNVIVDGSLDQETQVELYRAYVAFPDFLRNSTATWWKKEIEELYTNPR
EPEKSLKFDGLWIDMNEPSNFVDGSVWGCRDETLNNPPYVPYLESRDKGLSSKTLCMESQ
QVLPDGSLVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHWLGDN
TAAWDQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNTF
GTRRQDPVAWNSTFEMISRNVLQTRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTVDNKT
WEIDDQFMLGPAILISPVLESNTFEIHAYFPSARWYDYSTESGNTATGEWKTLQAPLDHI
NLHIRGGYILPWQESAMNTYSSRQKFMGLIVALDDNGKAEGEMFWDDGQSIDTYENGNYF
LAKFTAAQNILKIQTIHNKYLSDLNPLKVGYIRIWGINSMFVTQVTFTYDNQQFMETNFK
SDPYTQTLTIQLTDKDISLEKLTEITWIYGDPIVFTTPVTSTFPTSSLHPSTSSTKATTS
ETIITSSASTSTPAARTTTTLPITTTPFPTSTMEVTTSTTVPITTMPSSTNTPTARTTAT
LPITTTPFPTSTMEVTTSATVPITTVPSSTNSPTARTTATLPITTTPFPTSTMEVTTSTT
VPITTLPPSTNTPTARTTTTLPITTTPFPTSAIEVTTGTIVPITTMPSSTNTATATLPIT
TPPFPTSAIEVTTSATTPITTMPSPTNTPTTRTTATLPITTTPFPTSAIEVTTGTTVPIT
TVPSSTNSPTARTTATLPITTPPFPTSTMEVTTSTTVPITTMPSSTNIPTARTTTPLPTT
ATPFPTSAIEVTTGTTVPITTMPSPTNTPTVSGTSNTISVTTTSFQTPPTTLIHTLISTP
NSTPPSLSTFPTSNTFTTDLITDFTTPTNADTTHLNTMDTQGTMMMDAIVATTSTTNNTR
SPDTSKDKFTAHITQLTTPHSSPTTTQTLSHTTLISTNFSNPASVNATNTINITDADNVN
SVSGNTTHISIPNTTTASDGLMTAVLDTAIHHLVITNSTASNLSIIATNATTDVTNITIH
ALNTTTPDRKTMDASATASTYIANVVNATIVP
NT seq 7299 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcactgtattggaagtccttctgattgtcttcatcataatcatactt
gtcttagatatcctcctgctgcttcttgtgttggagaatccttcagatacagaaaatctt
ccagtgtgcccagagatccctgaatcagaaaggatagactgtgcgcctggccagatggtg
acagaggctgtctgcagatggcaacataaatgctgctggaagcctgggtcagatgctgat
gtccctacatgcttcttccccaggaactggggctataatgtcagcaatgactataaaaat
acaagcacagggtttactgcccagttgaaaaggttgtcatccccatctctgtttggatat
gatatcgtcgacaccctcttcacagctgaatatcagacagccaatcgttttcatttcaag
atcactgatttcaataacatgcgctatgaagtcccccatgaaaatattcagctgtttaat
gagactgttgatacctccaatttgagctatcacatagaggtcactcatatacccttcagc
atcaaaataatgaggacgagcaacaaaagagtcttgttggacacgagcattgggcccctc
ctgtttgcccagcagtacctgcagctgtctttccgactgcccagcgccaacgtgtatggg
ctgggggaacatgtgcaccagcagtaccgtcacaacatgacctgggagacctggcccatc
ttcacccgggatgccacccccactgagggcatgaataatctgtatggagctcatacattc
ttcttgtgccttgaagacaccagcggctcctcttttggggtttttctgttgaacagcaat
gctatggaggtcacccttcagcccgcccctgcaatcacttaccgcaccactgggggcatt
cttgacttttatgtgttcctgggaaacactccagaacaagtggtgcaggaatacctggag
cttgttggacgaccattcttgccttcatactggagtcttgggttccagcttagtcgcaga
aattatggtggcatcaacggattgaaagaggttgtagatcgaaatcgtgcagctgggatc
ccatatgatgtccagtattctgacatagactacatggatggaaagaaggatttcactatt
gatgaagaggtgttccctggtctctcaaattttatcaaagacttacatagcaatggaatg
aaatatgtaattgctatgaatcctggcatctcaaataactctgactacctgccctatgtg
aatgggacaaaaaagagagtatggatcttggatgacaatggctttgtcactgggcaggga
tatcccggatggacagtctttcccgattatagtaatcccatttgtactgagtggtggaca
gaggagttcagtgaatttcataaaactctggagtttgatggagtctggattgaaatggat
gaagtatctagttttctccaaggttctgatcatgagtgtgaatcaaacaacttgaacttt
cctcctttcactcctcgagtcctggaccacttcctttttgcaagaaccctctgcatggac
acggtgtttcactcgggccttcactatgatgtccacagcttgtatggctactccatggca
agagccacagactcggccatggagaatgtcttccccaataaaaggaacttcattttatcc
cgttctacttttgctggatctggcaaatttgttgctcattggttgggggacaatgcagcc
acatgggatgatctccgatggtccatccccagtatccttgagttcaacctatttggcatc
cccctggtaggtgccaacatctgtggttatagagaagatgtctcagaagaactctgcaga
aggtggatgcagcttggagcattttatccactatcaaggaatcataatgggcctgacttc
agggaccaggatcctgcagcctttggtgaaaactctcagctgttgaattcctccagacac
tatctgaacatccggtacaccctgctgccttatctctacagcctcttctaccgcgctcat
accctgggggagactgtagcaaggccccttgttcatgagttctaccaggacccagctaca
tgggaggtgcacgagcagttcttatgggggcctggactcctcatcacgcctgttctatat
gaaggtgtgacccaagtgaaagcatacatacctgatgccatctggtataactatgagacg
ggagtagccatccaatggaggaaacaattggtggagatgctactgtcagatgaaaagata
ggacttcaccttcgagggggctacatatttcccacccagcagccaaacacaaccacagag
aacagtcggaagaattcccttggactcattattgctttggactataagagagaagcaaag
ggggaactctactgggatgatggtgtatctaaagatgctgtcactgaaaagaattatatt
ttgtatgatttttccgtcacctcgaaccgtctacaggcaaagattataaatgataattat
atggatcctaacaacctcacgtttacaaatatcacaatcttgggaatggacaagcaacct
actaattttactgtcttatttaataatgctgccacccccattccaaatgttgtctacagt
gcttcaacaaaggtggtgagcatcactgatcttgagggactggtactgggacgagaattc
tccatcgggtggaatcttccagtcagtgacctggagaagttcaactgttaccctgaggac
cccagtgcctccgaggagagttgtaggcagcgggggtgcctttgggagcacacaactact
cctggtgtgcccacctgttactacgacaccatccctagttatgcagccagtaacattcag
tacctgcccacgggcatcaccacagaccttgccctcttgacagctcccgagtcagtggga
gcagcggcaccaccaccaccatcatcacgaggtgcgccacccccacctgcagcagcagcg
gccacctctgacgatctctctgcaaagatcgacttcctccaattgagcgtcatctaccac
acagaaaacatgctgcagttcaagatctatgaccccaggaataaaaggtatgaggtccca
gtgcctctgaacacccctccctctccagttggctcccctgaaaaccgtctgtatgatgtc
aggattcagaacaatcctttcgggatccagattcgacgaaaaagctccaatactgtgatc
tgggattctcagctccccggcttcaccttcaacgatatgttcctgtccatttctactcgc
ctcccttctgagtacatctatggctttggggaaactgagcacacaactttcaaaagaaac
atgagctggcacatgtggggaatgtttgctcgagatgagccaccagcgtacaagaagaat
tcctatagtgtccacccctactatatggcactggaggaggatggcagtgcccatggagtg
ctcctgctaaacagcaatgccatggatgtgacattccagcccactcctgccctgacgtac
cgcaccacaggagggattttggacttttatatgtttttgggaccaactccggagcttgta
actcagcaatacactgagttggtcggccggccggcaatgattccttactgggccttggga
ttccagctgagtcgctatggataccagaatgatactgaaatctccaatttgtatgatgca
atgatggcagcccagattccctatgatgtccagcatgtagacatcgattacatggaccgg
aagctggacttcactctcagctccagctttcaaaaccttggtctcctgattgagcaaatg
aagaaagatggcatgagatttattctcattctggacccagccatttctggcaatgagacc
cagtacctcacattcaccagagggcaggaaaacaacgtattcatcaaatggcctgacaac
agtgatattgtctggggaaaggtttggccagatctgcccaatgtgattgtggatggatcc
cttgaccaggaaactcaggttgagctgtacagagcctacgttgcttttcctgatttcttg
cgtaatagcacagccacatggtggaagaaggaaatagaagagctctatacaaaccctcga
gagccagaaaagagcttgaagtttgatggattgtggattgatatgaatgaaccatcgaac
tttgtggatggatctgtctggggctgcagagatgaaactcttaataatccaccctatgtg
ccatatctggagtccagggacaagggtctgagcagcaaaaccctgtgcatggagagtcag
caggtcctgccagatggctccctggtgcggcactacgatgtgcacagcctttacgggtgg
tcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtcatc
atcacccgctctactttcccctcttctggccgctggggaggacactggctgggagacaac
acggctgcatgggaccagctgaagaaatctatcattggcatgatggagttcagtctcttt
ggaatatcttatacgggagcagatatttgtgggttctttggagatgctgaatatgagatg
tgtgttcgttggatgcaactgggggcattttatccattttccaggaaccacaacacattc
gggacaaggagacaagatcctgtggcctggaattcaacctttgagatgatctcaagaaac
gtcctccagaccagatacaccctgctaccttacctctatactctgatgcataaagctcac
gttgagggcagcactgttgtccgaccccttctccatgagtttacagttgacaacaaaacg
tgggaaatagacgatcagttcatgttgggacccgccatcttaatcagccccgtgctagaa
agtaacacttttgagatccatgcttattttcccagtgctcgttggtatgactatagcacg
gaatctggcaatacagccacaggtgagtggaaaaccctgcaggctccccttgatcacatc
aaccttcacatcagaggaggctacatcctgccttggcaagagtctgcaatgaacacttac
tccagtcgacaaaaatttatgggattgattgttgctttggatgacaatgggaaagccgaa
ggtgagatgttctgggatgatggacaaagcattgatacctatgaaaatggaaactatttc
ttggcaaagtttacagcagctcagaacatattgaaaattcagaccatacacaataagtat
ttgagtgacttgaatccactgaaagttggatatattcgaatctgggggataaactctatg
tttgtgacacaagtgaccttcacctatgacaaccagcaattcatggagacaaatttcaag
agtgacccttacactcagacactaactattcaattgactgacaaggatatcagcctggaa
aagttaactgaaattacttggatttatggtgatcctatagtttttactacacccgtgaca
agtaccttcccaacgagttctctacatccttctacatcttctactaaggctaccacttct
gagactattatcactagttctgctagtacaagtactcctgctgctaggactactactact
cttcctatcacaaccactcctttcccaacaagtactatggaagttacaactagtactact
gttcctattaccactatgccttcctcaacaaatactcctactgctaggactactgctact
cttcctatcacaaccactcctttcccaacaagtactatggaagttacaactagtgctact
gttcctattaccactgtgccttcctcaacaaattctcctactgctaggactactgctact
cttcctatcacaaccactcctttcccaacaagtactatggaagttacaactagtactact
gttcctattaccactttgcctccctcaacaaatactcctactgctaggactactactact
cttcctatcacaaccactcctttcccaacaagtgccattgaagttacaactggtaccatt
gttcctattaccactatgccttcctcaacaaatactgctactgctactcttcctatcaca
acccctcctttcccaacaagtgccattgaagttacaactagtgctactactcctattacc
actatgccttccccaacaaatactcctactactaggactactgctactcttcctatcaca
accactcctttcccaacaagtgccattgaagttacaactggtaccactgttcctattacc
actgtgccttcctcaacaaattctcctactgctaggactactgctactcttcctatcaca
acccctcctttcccaacaagtactatggaagttacaactagtactactgttcctattacc
actatgccttcatcaacaaatattcctactgctaggactactactcctcttcctaccaca
gccactcctttcccaacaagtgccattgaagttacaactggtaccactgttcctattact
actatgccttccccaacaaatactcctactgttagtggtactagtaatactatttctgtc
acaactacttctttccagactcctcccaccactctaatccatactcttatttctactcct
aactctactcctcctagcttgagcacatttccaaccagtaatacatttactactgattta
atcactgattttactacacctactaatgcagacaccactcatctcaacaccatggataca
caaggtaccatgatgatggatgctatagttgctactaccagcaccacaaataataccagg
agtccagatacctccaaagataaattcactgcacacatcacacagctcactactccccat
tcttctcctactacaacacaaactttgagccacacaacgttaatttccacaaatttttct
aatccagcttctgtcaatgctactaacacaataaatattactgatgcagataatgtcaac
agtgtttcaggtaacactacacacatttctattccaaataccacaacagcctctgacggg
ttgatgactgctgttttagatacagcaatccaccatctggtaataacaaattctacagct
agtaatttatctattattgcaactaatgccaccacagatgttacaaatattaccatacat
gctttaaatactaccactcctgataggaaaacaatggatgcctctgctactgcatctact
tatattgcaaatgttgtaaatgctactatagttccatga

DBGET integrated database retrieval system