KEGG   Equus asinus (ass): 106842603Help
Entry
106842603         CDS       T04645                                 

Definition
(RefSeq) cationic trypsin-3-like
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
eai  Equus asinus (ass)
Pathway
eai04080  Neuroactive ligand-receptor interaction
eai04972  Pancreatic secretion
eai04974  Protein digestion and absorption
eai05164  Influenza A
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106842603
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    106842603
   04974 Protein digestion and absorption
    106842603
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    106842603
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:eai01002]
    106842603
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106842603
Enzymes [BR:eai01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     106842603
Peptidases [BR:eai01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106842603
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106842603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 106842603
NCBI-ProteinID: XP_014714697
LinkDB All DBs
Position
Un
AA seq 246 aa AA seqDB search
MKLLIFLALLGAAVASSTDDDDKIVGGYTCQANSVPYQVSLNVGYHICGGSLISNQWVVS
AAHCYQSRFQVRLGEHNIAVTEGNEQFINSAKVIRHPSYNSRTYDNDILLIKLSSPASIN
SKVSAISLPASFPAAGTQCLISGWGNTLSSGSNYPNLLQCLNAPILSDSSCRSSYPNQIT
SNMFCAGFLEGGKDSCQGDSGGPVACSGVLQGIVSWGYGCAQRNKPGVYTKVYNYVNWIR
QTIAAN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcttgatctttcttgctctcctgggagccgctgttgcttcctccactgacgat
gatgacaagattgtcgggggctacacctgtcaggcgaattccgtgccctaccaggtgtct
ctgaacgtcggctaccacatctgcggtggctcactcatcagtaaccagtgggttgtgtct
gctgctcactgctaccagtcccgattccaggtgcgtctgggagaacacaacattgcagtc
actgagggcaatgagcaattcattaattcagccaaggtcatccgccaccccagctacaat
tcaaggacctacgataatgacatcctgctgattaaactgagctccccggcctccatcaac
tctaaagtgtctgcgatctctctgccagcatctttcccagctgctggtacccagtgcctc
atctctggctggggaaacaccctcagcagtggctccaactaccctaacctcctgcagtgt
ctgaatgctcccatcctctccgatagttcttgccgcagttcctacccaaaccagatcacc
agcaacatgttctgtgcaggcttcctagagggtggaaaggactcctgccagggtgactct
ggtggccctgtggcttgcagtggagtgctccagggcattgtctcctggggctatggctgt
gctcagagaaacaagcctggtgtctacaccaaggtctacaactacgtgaactggattagg
cagaccatcgctgccaactaa

DBGET integrated database retrieval system