KEGG   Equus asinus (ass): 106842605Help
Entry
106842605         CDS       T04645                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00052  Galactose metabolism
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106842605 (MGAM)
   00500 Starch and sucrose metabolism
    106842605 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106842605 (MGAM)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106842605 (MGAM)
    3.2.1.20  alpha-glucosidase
     106842605 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 106842605
NCBI-ProteinID: XP_014714701
LinkDB All DBs
Position
Un
AA seq 1847 aa AA seqDB search
MARKKWKNFTTLELMLSALLLVLFIITIPIFVLSARDSLGSEDPGTTVTPDPGTTVTLNP
SSTAIPDHETTTTVPASAECPVVNELERINCIPDQPPTKATCDQRGCCWNPQGPIRVPWC
YYSQSHGYQMEDNLVNTNAGFTAQLKRLPSPSLFGNDVNNVLLTAECQTSNRFHFKLTDQ
NQDRYEVPHEHVQSFNGNAASALTYEVMVSKQPFSIKVTRRSNNRVLFDSSIGPLLFADQ
FLQLSIRLPSANVYGLGEHVHQQYRHDMNWKTWPIFNRDTTPNGDGTNLYGAQTFFLCLE
DASGLSFGVFLLNSNAMEVSLQPAPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRP
ALPSYWALGFHLSRYDYGSLDNMKEVVERNRAAQLPYDVQHADIDYMDERKDFTYNPVDF
KDFPEFAKELHNNGQKLIIIVDPAISNNSSPTQPYGPYDRGSDMKIWVNASNGVTPLIGE
VWPGKTVFPDYTNPQCAVWWAREFELFHNQVDFDGIWIDMNEVSNFIDGSVSGCSTSDLN
YPPFTPRVLDGYLFSKTLCMDAVQYWGKQYDVHNVYGYSMAIATAEAVNTVFPSKRSFIL
TRSTFAGSGKFAAHWLGDNTATWNDLRWSIPGILEFNLFGIPMVGPDICGFFLDSSEELC
RRWMQLGAFYPFSRNHNGQGYKAQDPAFFGADSLLVNSSRHYLTIRYTLLPYLYTLFYRA
HSRGDTVARPLLHEFYGDSSTWDVHQQFLWGPGLLITPVLEEGAEKVMAYMPDAVWYDYE
TGGRVRWRKQQVEMDLPGDKIGLHLRGGYIFPTQQPATTTVASRRNPLGLIIALDENKEA
KGELFWDDGETKDTVANQVYLLCEFSVTQNRLDVKILQSTYKDPNNLVFKEIKILGTQEP
WNVTVKHNGVSSQMSPNVTYDSNLQVALITELDLILGEAYTVEWELKVADEEKIDCYPDE
NGVSAENCTARGCVWEESSSPGVPFCYFVSDLYSVSDVQYDTHGATAVISLNSSPYAYAL
PSIPVNSLHLNVTYHKNDMLQFKIYDPNNNRYEVPVPLNIPQVPSSASESRLYDVLIKKN
PFGIEIRRKSTGTVIWDSQLLGFTFNDMFIRISTRLPSRYLYGFGENEHTAFRRDLNWHT
WGMFSRDQPPGYKKNSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGG
ILDFYVFLGPTPEIVTQQYTELIGRPVMVPYWSLGFQLCRYGYENDTEIANLYDDMVAAQ
IPYDVQYSDIDYMERQMDFTLSPKFAGFPDLITRMHADGMRVILILDPAISGNETQPYPA
FTRGVEDDVFIKAPGGGGIVWGKVWPDFPDVVVNDSLDWDTQVELYRAYTAFPDFFRNST
VKWWKREFEELYSNPQNPEKSLKFDGMWIDMNEPASFVNGAVPPGCMNATLNHPPYMPYL
ESRDSGLSSKTLCMESEQILPDGSRVRHYDVHSLYGWSQTRPTYEAVQEVTGQRGIVITR
STFPSSGRWAGHWLGDNTAAWDQLRKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCAR
WMQLGAFYPFSRNHNTIGTRRQDPVSWDATFVNISKTVLQTRYTLLPYLYTLMHLAHTEG
STVVRPLLHEFVSDQVTWDIDSQFLLGPAFLVSPVLEPNARNVTAYFPRARWYDYYTGED
IKARGEWKSLPAPLDHINLHVRGGYILPWQEPAQNTHLSRQKFIGFKVALDDDGTAEGCL
FWDDGQSIDTYEKGLYYLANFSASQNTMQSHVIFNQYILDTNPLKLGYIEIWGVGSAPVS
NVSVSLSSTVITPAFTYNPTTQVLNIDVTSRDISLHNFISLTWSSTL
NT seq 5544 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagtggaaaaatttcactactttggagcttatgctcagcgcacttctg
cttgtgttatttatcatcactattcctatatttgttctgtcagctagagattctttggga
tcagaagatcctgggacgacagtgaccccagatcctgggacgacagttaccctcaatcct
agttcgacagctatcccagatcatgagacaacaactaccgtccctgcttctgcagagtgc
ccagtggtgaatgaattggaacggataaactgcatccctgaccagccaccaacaaaggcc
acatgtgaccagcgtggctgctgttggaatcctcagggacccataagggtgccctggtgc
tactattctcagagtcatggttatcaaatggaggacaaccttgtaaacacaaatgcagga
ttcacagcccagttgaaaaggttgccttctccatctctgtttggaaatgatgtcaacaat
gtccttctcacagcggaatgtcagacatctaatcgtttccactttaagttaactgaccaa
aaccaggacaggtacgaagtgccccatgaacacgtgcaatccttcaatggaaatgctgct
tctgccttgacctatgaagttatggtctcaaaacagccatttagcatcaaagtgaccaga
agaagcaacaatcgtgttctgtttgactcaagcattgggcccctcttgtttgctgatcag
ttcctgcagctctccatccgtctgccgagcgctaatgtgtatgggctgggagaacatgtg
caccagcagtaccgtcatgatatgaattggaagacctggcccatatttaatagggacaca
acccccaatggggatggaactaacttgtatggtgcacagacattcttcctgtgtcttgaa
gatgctagtggattgtcatttggagtgtttctgttgaacagcaatgccatggaggtttct
ctccagcctgccccggcgatcacttaccgcaccatcgggggtattcttgacttctatgtg
ttcttgggaaacacgccagagcaagtcgttcaagagtatctggagctcattggacgacca
gccctaccttcatactgggcacttggatttcatctcagtcgttatgattatgggagcctg
gacaacatgaaagaagtcgtggagagaaatcgtgcagcacaacttccttacgacgttcag
catgctgatattgattatatggatgagaggaaggatttcacttataatccagtagatttt
aaagacttcccagagtttgctaaggagttacacaataatggacagaaactcatcatcatt
gtggatccagccatctccaacaactcttccccaactcaaccctatggcccctatgacagg
ggttcagatatgaagatatgggtgaatgcttcaaatggagtgactccactcattggggag
gtctggcctggaaaaactgtgtttcctgattataccaaccctcagtgtgctgtttggtgg
gcaagggaatttgaacttttccacaaccaagtggactttgatggaatctggattgatatg
aatgaagtctccaatttcattgatggttccgtttcaggatgttccacaagcgatctaaat
tatcccccattcactcccagagtccttgatgggtacctgttctccaagactctctgcatg
gatgcagtgcagtactggggcaagcaatatgatgtccacaatgtgtacggctactcgatg
gcgattgccacagcagaagcggtcaatactgtgttccctagtaagagaagctttattcta
acccgttctacctttgcgggatctggcaagtttgcagcccattggttaggagacaacaca
gccacctggaatgaccttcgatggtccatccctggcatccttgagttcaacctttttggt
atccctatggtgggtcctgacatatgtggctttttcttggattcctctgaagagctctgc
aggcggtggatgcagctgggagcattttatccattttccaggaatcacaatggccaaggc
tacaaggcccaggatcctgccttctttggagctgactctctgctggtgaattcctccagg
cactaccttaccatccgctatactctattgccatatctctacaccctcttctaccgagct
cacagccggggggacacggtggccaggccccttctgcatgagttctatggtgacagcagc
acttgggatgtgcaccaacagtttttatgggggcccggcctcctcatcactccagttcta
gaggagggtgcagagaaagtgatggcatatatgcctgatgctgtctggtatgattatgag
actgggggccgagtgagatggaggaagcaacaagtggagatggatcttcctggggacaaa
attgggcttcatcttcgaggaggctatatcttccctacacaacagccagccacaaccact
gtagccagtcgaaggaaccctcttggtcttatcattgctctagatgagaacaaagaagca
aaaggcgaacttttctgggatgatggggaaaccaaagacactgtggcaaatcaagtttat
ctcttatgtgagttttctgtcacccaaaaccgattagatgtgaagattttgcaatcaacc
tacaaagaccccaataatttagtatttaaagagattaaaatccttggaacccaggaacct
tggaatgttacagtgaaacacaacggtgtctcaagtcaaatgtctcctaatgtcacttat
gactcaaacctacaggttgcccttatcacagaacttgatcttatcctgggagaagcatac
actgtggagtgggagttgaaggtagcggatgaagaaaaaatagactgttatccagatgag
aatggtgtttctgcagaaaattgcactgcccgtggctgtgtctgggaggaatccagttct
cctggagtccctttttgctatttcgtcagtgacttatactctgtcagtgatgttcagtat
gacacccatggggccacagctgtcatctctttaaattcctctccttatgcctatgctttg
ccctcaatacccgtgaactccctccatctgaatgtgacctaccataagaatgacatgctg
cagtttaagatttatgatcccaacaacaaccggtatgaagttccagtccctctcaacata
ccccaggttccatccagtgcctctgagagtagactctatgatgtcctcattaagaagaat
ccatttgggattgaaattcgccggaagagtacaggcactgtaatttgggactctcagctc
cttggcttcaccttcaatgacatgttcatccgcatctccactcgccttccttcccggtac
ctctacggctttggggaaaatgagcacacagcctttcggagagacttgaactggcacaca
tgggggatgttttcccgagaccaacccccagggtacaagaagaattcctatggagtccac
ccctactacatggggctggaggaggatggcagtgcccatggggtgctcctgctaaacagc
aatgccatggatgtgacattccagcctttgcctgccttgacataccgcaccacaggggga
attctggacttttacgtgttcttggggccaactccagagattgtcactcagcaatacact
gagttgattggtcggccggtgatggttccttactggtccttggggtttcagctgtgtcgc
tatggatacgagaatgacactgagattgccaacttgtatgatgacatggtggctgcccag
atcccctatgatgtacaatactcagacattgactacatggagcggcagatggacttcacc
ctcagccccaagtttgctggatttccagatctgattactcgcatgcatgctgatgggatg
cgggtcatcctcattctggatccagccatttctggcaatgagacacagccctatcctgca
ttcacccggggtgtggaagatgacgtcttcatcaaagctccaggtggtggaggcattgtc
tggggaaaggtctggcctgattttcctgatgttgttgtaaatgattctttagactgggat
actcaagtggagctataccgagcttatacagccttcccagactttttccgtaattcaact
gtcaaatggtggaagagggagtttgaagaactatacagcaacccacagaatccagagaag
agcttgaagtttgatggcatgtggattgacatgaatgaaccggcaagctttgtgaatggg
gcagttcctccaggctgcatgaatgccactctgaaccaccctccctatatgccatatttg
gagtccagggacagcggtctgagcagcaagaccctttgcatggagagtgagcagatcctg
ccagatggctcccgggtgcggcactatgatgtgcacagcctgtacgggtggtcccagacc
agacccacatacgaagctgtgcaggaggtgacgggacagcgagggattgtcatcactcgt
tccacattcccctcttctggccgctgggcaggacactggttgggagacaacacggctgca
tgggaccaactgaggaaatctatcattggcatgatggagtttagcctctttggcatatcc
tatacaggagcagatatttgtgggttctttcaagatgctgaatatgagatgtgtgctcgc
tggatgcaactgggggccttttaccccttctcaaggaaccacaacaccattgggaccagg
agacaagaccctgtgtcctgggatgctacctttgtgaatatctccaaaactgtcctgcag
accagatacactctgttgccgtatctctacaccctgatgcacttggcccacacggagggc
agcactgttgtgcggcctcttctccatgagtttgtgtcagaccaggtgacctgggatata
gacagtcagttcctgctgggcccagccttcctggtcagccctgtcttggagcctaatgcc
agaaacgtcactgcatatttccccagagcccgctggtatgattactacacgggtgaggac
attaaagcaaggggagagtggaagtccttgccagcccctcttgaccacatcaatcttcat
gtccgagggggctacatcctgccctggcaagagcctgcacagaacacccacttaagccgt
cagaaattcataggtttcaaggttgcattggatgacgatgggactgctgaaggttgtctc
ttctgggacgatgggcaaagcattgatacctatgaaaaaggactctattatctggccaac
ttttctgccagccagaatacgatgcagagtcatgtaattttcaaccaatacatccttgac
acaaaccctttgaaactgggctacattgagatctggggagtgggcagtgctcctgtttcc
aatgtcagcgtctctctgagcagcacagttataacacccgccttcacctacaaccctaca
acacaggtgttaaacatcgatgtgaccagcagagacatcagcctacataatttcatctca
ttgacatggagcagcactctgtga

DBGET integrated database retrieval system