KEGG   Equus asinus (ass): 106842819Help
Entry
106842819         CDS       T04645                                 

Gene name
ALDH7A1
Definition
(RefSeq) aldehyde dehydrogenase 7 family member A1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
eai  Equus asinus (ass)
Pathway
eai00010  Glycolysis / Gluconeogenesis
eai00053  Ascorbate and aldarate metabolism
eai00071  Fatty acid degradation
eai00260  Glycine, serine and threonine metabolism
eai00280  Valine, leucine and isoleucine degradation
eai00310  Lysine degradation
eai00330  Arginine and proline metabolism
eai00340  Histidine metabolism
eai00380  Tryptophan metabolism
eai00410  beta-Alanine metabolism
eai00561  Glycerolipid metabolism
eai00620  Pyruvate metabolism
eai01100  Metabolic pathways
Module
eai_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
eai_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106842819 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    106842819 (ALDH7A1)
   00620 Pyruvate metabolism
    106842819 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106842819 (ALDH7A1)
   00561 Glycerolipid metabolism
    106842819 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106842819 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    106842819 (ALDH7A1)
   00310 Lysine degradation
    106842819 (ALDH7A1)
   00330 Arginine and proline metabolism
    106842819 (ALDH7A1)
   00340 Histidine metabolism
    106842819 (ALDH7A1)
   00380 Tryptophan metabolism
    106842819 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106842819 (ALDH7A1)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106842819 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     106842819 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     106842819 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106842819
NCBI-ProteinID: XP_014715023
LinkDB All DBs
Position
Un
AA seq 566 aa AA seqDB search
MGCPGRWAGLYFRGSSGRRRLVRPWLSMWRVGRQLCVQAAGGIRLSGLWNRPAAFMSTLL
INQPQYAWLKELELREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVK
KAQEAWRIWADVPAPKRGEVVRQIGDALREKIQVLGSLVSLEMGKILVEGVGEVQEYVDI
CDYAVGLSRMIGGPILPSERPGHALIEQWNPVGLVGIITAFNFPVAVYGWNNAIAMICGN
VCLWKGAPTTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADLGTAMAKDERVNLLSFT
GSTQVGKQVALMVQERFGRSLLELGGNNAIIAFEDADLSLVVPSALFAAVGTAGQRCTTA
RRLFLHESIHDEVVNRLKKAYAQVRVGNPWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGG
TVVYGGKVMDRPGNYVEPTIVTGLAHNASIAHTETFAPILYVFKFKNEEEVFAWNNEVKQ
GLSSSIFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtcccgggcggtgggcggggctctatttccgcggctcctcgggccgcaggcgc
cttgtgcgcccttggctcagtatgtggcgcgttggtcgccagctgtgtgtgcaagctgca
ggaggcatccggctctccggactttggaacaggcctgccgccttcatgtccactctgctc
atcaatcagccccagtatgcctggctcaaggagctggagctccgcgaggagaacgagggc
gtgtataatggaagctggggcggccggggagaggttatcacgacctattgtccagctaac
aatgagccaatagcaagagtccgacaggccagtgtggccgactatgaagagaccgtaaag
aaagcacaagaagcatggagaatctgggcggatgttcctgctccaaagcgaggagaagta
gtgagacagattggtgatgccctgcgggagaagatccaagtactaggaagcttggtgtct
ttggagatggggaagatcttagtggaaggtgtgggagaagtccaggagtacgtggatatt
tgtgattatgctgttggcttatcacggatgattgggggacccatcttgccttcggaaaga
cctggccatgcactcattgaacagtggaatcctgtaggcctggttggaatcatcactgcg
ttcaacttccctgtggcggtgtatggctggaacaatgccattgcaatgatctgtgggaat
gtctgcctttggaaaggagctccaacaacttccctcattagtgtggctgttacaaagata
atagccaaggttctggaggacaacaagctgcctggtgcgatttgttccttgacttgtggt
ggagcagatcttggcacagcaatggccaaagatgagcgagtgaacctgctgtccttcact
gggagcactcaggtgggaaaacaggtggcccttatggtgcaggagaggtttgggagaagt
ttgttagagcttggaggaaacaatgccattattgcttttgaggatgcagacctcagttta
gttgttccatcagctctctttgcggccgtggggacagctggccagaggtgtaccaccgca
aggcgcctgtttttacatgaaagcatccacgacgaagttgtaaatagactcaaaaaggcc
tatgcacaggttcgcgtcgggaacccctgggactctaatgtgctctatgggccactccat
accaagcaggcagtgagcatgtttcttggagcagtggaagaagcaaagaaagaaggtggc
accgtggtctatggtggcaaggttatggatcgccctggaaattacgtagaaccgacgatt
gtgacaggtcttgcccacaacgcgtccattgcacacacagagacttttgctccgattctt
tatgtctttaaattcaagaatgaagaagaggtctttgcatggaataatgaagtaaaacag
gggctttcaagtagcatcttcaccaaggatttgggcagaatcttccgctggcttggaccg
aaaggatcagactgcggcattgtaaacgtcaatattccaacgagtggggctgagattgga
ggtgcatttggaggagaaaagcacaccggtggtggcagggagtccggtagcgatgcctgg
aagcagtacatgcgaagatctacttgtaccatcaactacagtaaggaccttcctctggct
caaggaatcaagtttcagtaa

DBGET integrated database retrieval system