KEGG   Equus asinus (ass): 106843652Help
Entry
106843652         CDS       T04645                                 

Gene name
ATM
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
eai  Equus asinus (ass)
Pathway
eai01524  Platinum drug resistance
eai03440  Homologous recombination
eai04064  NF-kappa B signaling pathway
eai04068  FoxO signaling pathway
eai04110  Cell cycle
eai04115  p53 signaling pathway
eai04210  Apoptosis
eai04218  Cellular senescence
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05170  Human immunodeficiency virus 1 infection
eai05202  Transcriptional misregulation in cancer
eai05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    106843652 (ATM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    106843652 (ATM)
   04068 FoxO signaling pathway
    106843652 (ATM)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106843652 (ATM)
   04210 Apoptosis
    106843652 (ATM)
   04115 p53 signaling pathway
    106843652 (ATM)
   04218 Cellular senescence
    106843652 (ATM)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    106843652 (ATM)
   05206 MicroRNAs in cancer
    106843652 (ATM)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106843652 (ATM)
   05170 Human immunodeficiency virus 1 infection
    106843652 (ATM)
   05165 Human papillomavirus infection
    106843652 (ATM)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    106843652 (ATM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106843652 (ATM)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:eai03032]
    106843652 (ATM)
   03400 DNA repair and recombination proteins [BR:eai03400]
    106843652 (ATM)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     106843652 (ATM)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   106843652 (ATM)
DNA replication proteins [BR:eai03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     106843652 (ATM)
DNA repair and recombination proteins [BR:eai03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    106843652 (ATM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC GUN4
Motif
Other DBs
NCBI-GeneID: 106843652
NCBI-ProteinID: XP_014716249
LinkDB All DBs
Position
Un
AA seq 3064 aa AA seqDB search
MSLALNDLLICCRQLGHDRATERRKEVEKFKRLIRDPETVKQLDQHLDSKQGKYLNWDAV
FRFLQKYIQKEIEHLRTAKPNVSASTQAGRQKKMQEISSLVKYFIKCANKRAPKLKCQEL
LNYIMDTMKDSSNGAISGADCSNILLKDILSVRKYWCEISQQQWLELLSVYFRLYLKPSQ
DINRVLVARIIQAVTKGCCSQTDGLNSKFLEYFSKAIQHARQEKSSAGLSHILAAFILFL
KTLAVNFRIQVCELGDEILPTLLYVWTQHRPNDSLKEVMIELFQLQIYIHHPKGAKTQEK
GAYESRKWKSILYNLYDLLVNEISHIGSRGKYSSGSRNIAVKENLIELMADICHQVFSED
TKSLEISQSYATTQRECNDSSVSCKKRKIELGWEVINDHLQKSQNDFDLVPWLQIATQLI
SKYPASLPNCELSPLLMILCQLLPQQRRGERTPYVLRCLMEVALCQGKKSNLESSQKSDL
LKLWNKIWCITFRGISSEQIQAENFGLLGAIIQGSLIEVDREFWKLFTGSACKPSFPAVC
CLTLALTICVVPETVKTGMEQNICEVNRSSSLKELIMKWLLFYQLEDDFEDSTELPPILH
SNFPHLALEKILVSLTMKNCQAAMSFFQSVPECEKHQKDQDEPSFSEVEDIFLQTTFDKM
DFLTIGKEHATEKHQPSIGFSVHQNLKESLNRCLLGLSEQLLNNYSSETTNSETLVRCSS
LLVGVLGCYRYVGVIAEEEAYKSELFQKAKSLMQCAGESITLFTNKTNEESRIVSLRNMM
HLCTSCLCNCTKHSPNKIASGFFLRLLTSKLMNDIADICRSLASFTKKPFDYGEVESMQD
DTDKNLMETEDQSSMNLFDDCPTVSVGDANESGENQSTVGAINPLAEEHLSKQDLLFLDM
LKFLCMCVTSAQTNTVSFRAADIRRKLLMLLDSSMLDPAKSLHLHMYLVLLKELPGEEYS
LPMGDVVELLKPLSNVCSLYHRDQDVCKTVLNHVLHVVMNLRQGNVDAENTKDAQERFLK
VIEVFWRLTKEGKYAFSVRMALVKCLKTLLEADPYSKWAILKVNGNNFPVNEVFPQFLAD
DHHQVRMLAAESISRLFQDMEQGSSSRLLKALPLKLQQTAFENAYLKAQEGMRQVSQRAE
NPELLDDIYNRKAVLLMMIAVVLCCSPVCEKQALFALCKSVKDDGLEPHLVKKVLEKVSE
TFGYRNLEDFMASHLDYLILEWLNLRDNEYSLSSFPFILLNYANVEDFYRSCYKVLIPHL
VIRSDFDEVKSIANQIQEDWKSLLTDCFPKILVNILPYFAYEDTGDSGLAQQRETATKVY
DMLKDENVLGKQIDHLFRSNLPEIVVELLMTLHEPATSGTSQSTDLCDFSGDLDPAPNPP
HFPSHVIKATFAYISSCHKTKLKSIVEILSKSPDSYQKILLAICVQAAETNNIYKKHRIL
KIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINKRPSPFRDVSLRSFSLCCDLLS
QVCHTAVTYCKDALESHLHVIVGTLIPLVDDQMEVQKQVLDLLKYLVIDNKDNENLYMTI
KLLDPFPDHVVFKDLRITQQKIKYSGGPFSLLEEINHFLSVSKYDALPLTRLEGLKDLRR
QLEQHKDQMMDLMRASQDNPQGGIMVKLVVGLLQLSKMAINHTGEREVLEAVGSCLGELG
PIDFSTIAVQHSKDTSYTKALELFEDKELQWTFIMLTYLNDTLVEDCVKVRSAAVTCLKN
ILATKTGHSFWEIYKKTTDPMLIYLHPFRTSRKKFLEVPRIDKENPLEGLDDTSLWIPQS
KNHDIWIKTLTCAVLDSGGTKSEILQLLKPMCEVKTDFCQTVLPYLIHDILLQDTNESWR
NLLSTHIQGFFTNCFRHSSQTSRSTTPANLDSESEHIFRGCLDKKSQRTMLAIVDYMRRQ
KRPSSGTVFDDAFWLELNYLEVAKVAQSCAAHFTALLYAEIYADKKSMEDQEKRSTLVTN
RSLTFEEGSQSTTISSLSEKSKEESGISLQDLLLEIYRSIGEPDSLYGCGGGKMLQPLTR
LRTYEHEAMWGKALVTYDLETAISSSTRQAGIIQALQNLGLCHILSVYLKGLDHENKEWC
AELQELHYQAAWRNMQWDHCICVNKGAEGASYHKSLYNALQSLRDREFSTFYESLKYARV
KEVEELCKGSLESVYSLYPTLSRLQTIGELENIGELFSRSVTDRQPSEVYIKWRKHSQLL
KDSDFSFQEPIMALRTVILEILMEKEMESSQRQCFKDILTKHLVELSTLARTFKNTQLPE
RAIFQIKQYNSASCGVSEWQLEEAQVFWAKEEQSLALSILKQMIKKLDASCTENDPNLKL
MYTECLRICGNWLAETCLENPAVIMQTYLEKAVEVAGNCDGESNDELRNGKMKAFLSLAR
FSDTQYQRIENYMKSSEFENKQALLKRAKEEVGLLREHKIQTNRYTIKVQRELELDECAL
RALKEDRKRFLCKAVENYISCLLSGEGHDMWIFRLCSLWLENSGVSEVNGMMKRDGIKIP
SYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANKDEFL
TKPEAARRSRITKSAPKQSSQLDEDRTEAANKIVHTIRSRRPQMIRSVEALCDAYIILAN
LDATQWRTQRQGINIPADQPITKLQNLEDVVVPTMEIKVDPTGEYENLVTIQSFKAEFRL
AGGLNLPKIIDCLGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNTETRKRKLTI
CTYKVVPLSQRSGVLEWCTGTVPIGEFLVNNENGAHKRYRPEDFSALQCQKKMMDVQKKS
FEEKYATFMDICQNFQPVFRYFCMEKFLDPAVWFEKRLAYTRSVATSSIVGYILGLGDRH
VQNILINEQSAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCE
KTMEVMRNSQETLLTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHSTPHADDQECK
RNLSDVDQSFNKVAERVLMRLQEKLKGVEEGTVLSVGGQVNLLIQQAMDPKNLSRLFPGW
KAWV
NT seq 9195 nt NT seq  +upstreamnt  +downstreamnt
atgagtctagcacttaatgatctgcttatttgctgccgtcaactaggacatgatagagct
acagaacgaaggaaagaagttgagaaatttaagcgcctgattcgcgatcctgaaactgtt
aaacagttagatcagcatttagatagcaaacaagggaaatatttgaattgggatgctgtt
tttagatttttacagaaatatattcagaaagaaatagaacatctgagaacagcaaaacca
aatgtatcagcctcaacacaagccggcaggcagaaaaagatgcaagaaatcagtagtttg
gtcaaatacttcatcaaatgtgcaaataaaagagcacccaagctaaaatgtcaagaactc
ttgaattatatcatggatactatgaaagattcatctaatggtgccatttctggagctgac
tgtagcaacattctgctcaaggacattctttcagtgagaaaatattggtgtgaaatatct
cagcaacagtggctagaattgctctctgtgtacttcaggctgtatcttaaaccttcacaa
gacattaatagggttttagtggctagaataattcaagctgtgactaaaggatgctgttcg
caaactgatggattaaattctaaatttttggaatatttttccaaggctattcagcatgca
agacaagaaaagagttctgcaggtctaagtcatatcttagcagcatttattctcttcctc
aagactttggctgttaactttcgaattcaagtgtgtgaattaggagatgaaattcttcct
accttgctttatgtttggactcaacatagacctaatgattccttaaaagaagtaatgatt
gaattatttcaactgcaaatttatatccatcatccaaagggagcaaaaacccaagaaaaa
ggtgcttatgaatcaaggaaatggaaaagtatcttatacaacttatatgatctgctagtt
aatgagataagtcatataggaagcagagggaaatattcttcaggatctcgtaatattgct
gtcaaggaaaacctgattgaattgatggcagatatttgtcaccaggttttcagtgaagat
accaaatctttggagatttctcagtcttatgccaccacacaaagagaatgtaatgattcc
agtgtatcttgcaaaaagaggaaaatagaattaggctgggaagtaataaacgatcatctt
cagaagtcacagaatgattttgatcttgtgccttggttacagattgcaacccagttaata
tcaaaatatcctgcaagtttacctaattgtgagctgtcaccattactgatgatactatgc
cagcttctgcctcaacagcgacgtggggagcgcacaccatatgtgttacgatgccttatg
gaagttgcgttatgtcaaggcaagaaatcaaacctagaaagctcacaaaagtcagattta
ttgaaactctggaataaaatttggtgtattacctttcgtggtataagttctgaacaaata
caagctgaaaactttggtttacttggagccataattcaaggcagtttaattgaggttgat
agagaattctggaagttatttactgggtcagcctgcaaaccttcatttcctgcagtatgc
tgtttgactttggccttgaccatttgtgtagttccagaaacagtaaaaacaggaatggaa
cagaatatatgtgaagtaaatagaagttcttctttaaaagaattgataatgaaatggctc
ttattctatcagttagaggatgactttgaagacagtacagagctgcctccaattcttcac
agtaattttcctcatcttgcgctggagaagattcttgtgagtctcactatgaaaaactgt
caagctgcaatgagttttttccaaagtgtgccagaatgtgaaaaacaccaaaaagatcaa
gatgagccttcattctcagaagttgaagacatatttcttcagacaacttttgacaagatg
gattttttaaccattgggaaagaacatgctacagaaaagcaccaacccagtataggcttt
tctgtccaccaaaacctcaaggaatcactgaatcgctgtcttttgggattatcagaacaa
cttctaaataactactcatctgagactacaaattcagaaacacttgtccggtgttcaagt
cttttggtgggtgttcttggctgctatcgttatgtgggtgtaatagctgaagaggaagca
tataaatcagaattattccagaaagccaagtctctaatgcagtgtgcaggagaaagtatc
actctgtttacaaataagacaaatgaagaatctagaattgtttcactgagaaatatgatg
catctatgtacaagttgcttgtgtaactgtaccaagcacagtccaaataagattgcatct
ggctttttcctacgattgttaacatcaaagctaatgaatgatattgctgatatttgtaga
agtttagcatcttttaccaaaaagccatttgactatggagaagtagaatcaatgcaagat
gatactgataaaaatctgatggagacggaggatcagtcctccatgaatctatttgatgat
tgccctactgttagtgttggtgatgcaaatgaatctggagagaaccaaagtactgtcggt
gccataaatcctttagctgaagaacatctgtcaaagcaagatctactttttttagacatg
ctcaagttcttgtgtatgtgtgtaactagtgctcagaccaatactgtgtcatttagagca
gctgatattcggaggaaattgttgatgttacttgattctagcatgctagaccctgctaaa
tctctccacctacacatgtatctagtgcttttaaaggagctgcccggagaagaatattcc
ttgccaatgggagatgttgttgaacttctgaaaccactatccaatgtgtgttctttatat
caccgtgaccaagatgtttgtaagacagttttaaaccatgttcttcatgtagtgatgaac
ctacgtcaaggcaatgtggatgctgagaacacaaaggatgctcaagaacggtttctaaaa
gtgattgaagtattttggcgcttaacaaaggaggggaaatacgcattctctgtaagaatg
gcactggtaaaatgccttaaaaccttgcttgaggccgatccttattcaaaatgggctatt
cttaaggtaaatggaaacaactttcctgtaaatgaagtatttccacaatttcttgctgat
gatcatcaccaagttcgcatgttggctgcagagtcaatcagcagattattccaggatatg
gaacaaggaagttcttccaggttattgaaagcacttcctttgaagcttcagcaaacagct
tttgaaaatgcatacttgaaagctcaagaaggaatgagacaagtgtcccagagagctgag
aaccctgaacttttggatgatatttataatagaaaagctgttttactgatgatgatagct
gtggttttatgctgtagccctgtctgtgaaaaacaggctttgtttgccctatgcaagtct
gtgaaagacgatggattagaacctcaccttgttaaaaaggttttagagaaagtttctgaa
acttttggatatagaaatttagaagacttcatggcttctcatttggattatctaattttg
gaatggctaaatcttcgagataatgaatacagtttatcttcttttccttttatcttatta
aactacgcaaatgttgaggatttctatagatcttgttacaaagttttgattccacatctg
gtgattagaagtgattttgatgaggtgaagtccattgctaatcagattcaagaggattgg
aaaagtcttctaacagactgctttccaaagattcttgtaaatattcttccttactttgcc
tatgaggatactggagacagtggattggcacagcaaagagagactgctaccaaagtctat
gacatgcttaaagatgaaaatgtattaggaaaacagattgatcatttattcaggagtaat
ttaccagagattgtggtggagttattgatgaccttacatgaaccagcaacttctggtacc
agccaaagcactgacctctgtgacttttcaggggatttggatcctgctcctaatccacct
cattttccgtcacatgtgattaaagcaacatttgcctatatcagcagttgccataaaacc
aagcttaaaagcattgtagaaattctttccaaaagccctgattcctatcagaaaattctt
ctagccatatgtgtgcaagcagctgagacaaataatatttataaaaagcacagaattctt
aaaatatatcacctgtttgttagcttattactgaaagatataaaaagtggcttaggagga
gcttgggcctttgttcttcgagatgttatttatactttgattcactatatcaacaaaagg
ccttctcctttcagggatgtgtcattacgcagcttctctctttgctgtgacctgttaagc
caggtttgccacacagcagtaacttactgtaaggatgctttagaaagtcacctccatgtt
attgttggtacactcataccccttgtggacgatcagatggaggttcagaagcaggtattg
gacttgttgaaatacttagtgatagataacaaggataatgaaaacctctatatgacaatt
aaacttttagatccttttcctgaccatgttgtctttaaggatttgcgtattactcagcag
aaaatcaaatacagtggaggacctttttcactcttggaggaaattaaccattttctctca
gtaagtaagtatgatgcacttccgttgacaaggcttgaaggattgaaggatcttcggaga
cagctggaacaacataaagatcagatgatggatcttatgagagcgtcccaggataaccca
caaggtggcataatggtgaagttggttgtcggcttgttgcagttatccaagatggcaata
aaccacactggcgaaagggaagttttagaggctgttggaagctgcttgggagaactgggt
cctatagatttctctaccatagctgtacagcatagtaaagatacatcttataccaaggcc
ctcgagttatttgaagataaagaacttcagtggaccttcataatgttgacctacctgaat
gatacactggtagaagattgtgtcaaagtgcgatcagctgctgttacctgtttgaaaaac
attttagccacaaagactggacatagtttctgggagatttataagaagacaactgacccc
atgctgatctatctacacccttttagaacatcgagaaaaaagtttttagaagtacccaga
attgacaaagaaaaccctttagaaggcctggatgatacaagcctgtggattcctcaaagt
aaaaatcatgacatttggataaagacactgacttgtgctgttttggatagtggaggcaca
aaaagtgaaattcttcagttattgaagccaatgtgtgaagtgaaaactgacttttgtcag
actgtgcttccatacttgattcatgatattttactccaagatacaaatgaatcatggaga
aatctgctttctacacacattcagggattttttactaactgtttcagacattcttcacaa
acaagtcgatccacgacccctgcaaatttggattcagagtcagagcacattttccgaggc
tgtttggataaaaaatcacaaagaacaatgcttgctattgtggactacatgaggagacaa
aagagaccttcctcaggaacagtttttgatgatgccttctggctggagttgaattatctt
gaagttgccaaggtagctcagtcttgtgctgctcactttacagcattgctctatgctgaa
atctacgcagacaagaaaagcatggaggatcaagagaaaagaagtactcttgtgacaaac
agaagtcttacatttgaagaagggagccaaagtacaactatttctagtttgagtgaaaaa
agtaaagaagaaagtggaataagtttacaggatctgctgttagagatctacagaagtata
ggagaaccagacagtctgtatggctgtgggggaggaaaaatgttacaaccccttactaga
ctacgaacatacgaacatgaagcaatgtggggaaaagccctagtaacatacgaccttgag
acagcaatctcctcatcaacccgccaggcagggataattcaggccttgcagaatttggga
ctctgccacattctttctgtctatttaaaaggattagatcatgaaaataaagagtggtgt
gctgaactacaagaacttcattaccaagcagcatggaggaatatgcaatgggaccactgc
atttgtgtcaacaaaggagcagaaggagccagttaccacaagtcgttgtacaatgctctg
cagtctctaagagacagagaattctccacgttttatgaaagtctcaaatatgccagagtg
aaagaagtggaagaattgtgtaaaggtagccttgagtctgtgtattcactctaccccaca
cttagcagattgcagaccattggagagctcgaaaacattggggagcttttctcaagatca
gtcacagataggcaaccctctgaagtctacattaagtggcgaaagcactcccagcttctc
aaagacagtgattttagttttcaggagcctatcatggctctacgcacagtcattttggag
atcttgatggaaaaggaaatggagagctcccaaagacagtgtttcaaggacattctcacc
aagcatcttgtagaactctccacactagcccgaactttcaagaacactcagctccctgaa
agggcaatatttcaaattaaacagtataattcagctagttgtggagtctctgagtggcag
ctggaggaagcgcaagtattctgggcaaaagaggagcagagccttgccctgagtattctc
aagcaaatgatcaagaagttggatgccagttgtacagagaatgatccaaacctaaaactt
atgtacacagaatgtctgaggatttgtggcaactggttagcagaaacttgcttagaaaat
cctgcagtcatcatgcagacctatctggaaaaggcagtagaagttgctggaaattgtgat
ggagaaagcaatgatgagctcagaaatggaaaaatgaaggcctttctctctttagcacgg
ttctcagatactcagtaccaaagaattgaaaactacatgaaatcatcagaatttgaaaac
aagcaagctctcctgaaaagggccaaagaggaagtgggccttcttagggaacataaaatt
cagaccaacagatacacaataaaggttcagcgagagctggagctggatgaatgtgctctc
cgtgcactgaaggaggatcgtaaacgtttcttatgtaaagcagttgaaaattacatcagt
tgcttattaagtggagaagggcatgatatgtggatattccgtctttgttccctctggctt
gaaaattctggagtatctgaagtcaatggcatgatgaagagagatggaataaagattcca
tcgtataaatttttgcctcttatgtaccaattggctgctagaatggggaccaagatgatg
ggaggcctaggatttcatgaagtcctcaataacctcatctctagaatttcaatggatcac
ccccatcatactttgtttattatacttgcattagcaaatgcaaacaaagatgaatttttg
accaaaccagaggcagcaagaaggagtagaataactaaaagtgcacctaaacaaagctct
cagcttgatgaggatcgaactgaggctgcaaacaaaatagtacatactatcaggagtaga
agacctcagatgatcagaagtgttgaggcgctttgtgatgcttatattatattagcaaac
ttagatgccactcagtggaggactcagagacaaggcataaatattccagcagaccagcca
attactaaacttcagaacttagaagatgttgttgtccctactatggaaattaaggtggac
cccacaggagaatatgaaaatctggtgactatacaatcatttaaagcagaatttcgttta
gcaggaggtctaaatttaccaaaaataatagattgtttgggctctgatggcaaagaaagg
agacagcttgtcaagggccgtgatgacctgagacaagatgctgtcatgcagcaggttttc
cagatgtgcaatacattactgcagagaaacactgaaaccaggaagaggaaattgaccatc
tgcacatataaggtggttcccctctctcagcgaagtggtgttcttgagtggtgcacagga
acggtccctattggtgaatttcttgttaacaacgagaatggtgcccataaaagatacagg
ccagaggatttcagtgcccttcaatgccaaaagaaaatgatggatgtgcaaaagaagtct
tttgaagagaagtatgcaaccttcatggatatttgccaaaattttcaaccagttttccgt
tacttctgcatggaaaaattcttggacccagctgtttggtttgagaaacgattggcttat
actcgcagtgtggcgacttcttctattgttggttacatacttggacttggtgatagacat
gtacagaatatcttgataaacgagcagtcagcagaacttgtacatatagatttaggagtt
gcttttgaacagggtaaaatccttcctactcctgaaacagttccttttcgactcaccaga
gatattgtggatgggatgggcattactggtgttgaaggtgtcttcagaagatgctgtgag
aaaaccatggaggttatgagaaactctcaggaaaccctgttaaccattgtagaggtcctc
ctgtatgatcctctctttgactggaccatgaatcctttgaaagctttgtatttacagcag
aggccagaagatgaaactgagctccactccaccccacatgcagatgaccaagaatgcaaa
cgaaatctcagtgatgttgaccagagtttcaacaaagtagctgaacgggtcttgatgaga
ctgcaagagaagctgaaaggagtggaggaaggaaccgtgctcagtgtgggtggacaggtg
aatctgctcatacaacaggccatggaccccaaaaatctcagccgtcttttcccaggatgg
aaagcttgggtgtga

DBGET integrated database retrieval system