KEGG   Equus asinus (ass): 106844248
Entry
106844248         CDS       T04645                                 

Gene name
CCND1
Definition
(RefSeq) cyclin D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
eai  Equus asinus (ass)
Pathway
eai01522  Endocrine resistance
eai04068  FoxO signaling pathway
eai04110  Cell cycle
eai04115  p53 signaling pathway
eai04151  PI3K-Akt signaling pathway
eai04152  AMPK signaling pathway
eai04218  Cellular senescence
eai04310  Wnt signaling pathway
eai04340  Hedgehog signaling pathway
eai04371  Apelin signaling pathway
eai04390  Hippo signaling pathway
eai04510  Focal adhesion
eai04530  Tight junction
eai04630  JAK-STAT signaling pathway
eai04917  Prolactin signaling pathway
eai04919  Thyroid hormone signaling pathway
eai04921  Oxytocin signaling pathway
eai04933  AGE-RAGE signaling pathway in diabetic complications
eai04934  Cushing syndrome
eai05160  Hepatitis C
eai05162  Measles
eai05163  Human cytomegalovirus infection
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05169  Epstein-Barr virus infection
eai05200  Pathways in cancer
eai05203  Viral carcinogenesis
eai05205  Proteoglycans in cancer
eai05206  MicroRNAs in cancer
eai05210  Colorectal cancer
eai05212  Pancreatic cancer
eai05213  Endometrial cancer
eai05214  Glioma
eai05215  Prostate cancer
eai05216  Thyroid cancer
eai05218  Melanoma
eai05219  Bladder cancer
eai05220  Chronic myeloid leukemia
eai05221  Acute myeloid leukemia
eai05222  Small cell lung cancer
eai05223  Non-small cell lung cancer
eai05224  Breast cancer
eai05225  Hepatocellular carcinoma
eai05226  Gastric cancer
eai05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    106844248 (CCND1)
   04340 Hedgehog signaling pathway
    106844248 (CCND1)
   04390 Hippo signaling pathway
    106844248 (CCND1)
   04371 Apelin signaling pathway
    106844248 (CCND1)
   04630 JAK-STAT signaling pathway
    106844248 (CCND1)
   04068 FoxO signaling pathway
    106844248 (CCND1)
   04151 PI3K-Akt signaling pathway
    106844248 (CCND1)
   04152 AMPK signaling pathway
    106844248 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106844248 (CCND1)
   04115 p53 signaling pathway
    106844248 (CCND1)
   04218 Cellular senescence
    106844248 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    106844248 (CCND1)
   04530 Tight junction
    106844248 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    106844248 (CCND1)
   04921 Oxytocin signaling pathway
    106844248 (CCND1)
   04919 Thyroid hormone signaling pathway
    106844248 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106844248 (CCND1)
   05206 MicroRNAs in cancer
    106844248 (CCND1)
   05205 Proteoglycans in cancer
    106844248 (CCND1)
   05203 Viral carcinogenesis
    106844248 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    106844248 (CCND1)
   05212 Pancreatic cancer
    106844248 (CCND1)
   05225 Hepatocellular carcinoma
    106844248 (CCND1)
   05226 Gastric cancer
    106844248 (CCND1)
   05214 Glioma
    106844248 (CCND1)
   05216 Thyroid cancer
    106844248 (CCND1)
   05221 Acute myeloid leukemia
    106844248 (CCND1)
   05220 Chronic myeloid leukemia
    106844248 (CCND1)
   05218 Melanoma
    106844248 (CCND1)
   05219 Bladder cancer
    106844248 (CCND1)
   05215 Prostate cancer
    106844248 (CCND1)
   05213 Endometrial cancer
    106844248 (CCND1)
   05224 Breast cancer
    106844248 (CCND1)
   05222 Small cell lung cancer
    106844248 (CCND1)
   05223 Non-small cell lung cancer
    106844248 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    106844248 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    106844248 (CCND1)
   04934 Cushing syndrome
    106844248 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106844248 (CCND1)
   05162 Measles
    106844248 (CCND1)
   05160 Hepatitis C
    106844248 (CCND1)
   05163 Human cytomegalovirus infection
    106844248 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106844248 (CCND1)
   05169 Epstein-Barr virus infection
    106844248 (CCND1)
   05165 Human papillomavirus infection
    106844248 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106844248 (CCND1)
SSDB
Motif
Pfam: Cyclin_C
Other DBs
NCBI-GeneID: 106844248
NCBI-ProteinID: XP_014717079
LinkDB
Position
Un
AA seq 182 aa
MQKDARQLSGAALRASLRLSTPCPQQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAED
NKQIIRKHAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSTNSFLSYHRLTRFL
SKVIKCDPDCLRACQEQIEALLESSLRQAQQQNLDPKAAEEEEEEEEVDLACTPTDVRDV
NI
NT seq 549 nt   +upstreamnt  +downstreamnt
atgcagaaagatgctcggcagctctcaggagccgccctgcgcgcctctttacgcttgtcc
accccatgtccgcagcaaatggagctgctcctggtgaacaagctcaagtggaacctggcg
gccatgaccccgcacgatttcatcgaacacttcctctccaaaatgccggtggccgaggac
aacaagcagatcatccgcaagcacgcgcagaccttcgtcgccctctgtgccacagacgtg
aagttcatttccaacccaccctccatggtggctgccgggagcgtggtggccgcggtgcaa
ggcctgcatctggggagcaccaacagcttcctgtcctaccaccgcctcacgcggttcctc
tccaaagtgatcaagtgtgacccggactgcctgcgggcctgccaggagcagatcgaggcc
ctgctggagtccagcctgcgccaggcccagcagcagaacctggaccccaaggccgcggag
gaggaggaggaggaagaggaggtggacctggcctgcacgcccaccgacgtgcgggacgtg
aacatttga

DBGET integrated database retrieval system