KEGG   Equus asinus (ass): 106844316Help
Entry
106844316         CDS       T04645                                 

Gene name
PRKACA
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
eai  Equus asinus (ass)
Pathway
eai01522  Endocrine resistance
eai04010  MAPK signaling pathway
eai04014  Ras signaling pathway
eai04020  Calcium signaling pathway
eai04024  cAMP signaling pathway
eai04062  Chemokine signaling pathway
eai04114  Oocyte meiosis
eai04140  Autophagy - animal
eai04211  Longevity regulating pathway
eai04213  Longevity regulating pathway - multiple species
eai04261  Adrenergic signaling in cardiomyocytes
eai04270  Vascular smooth muscle contraction
eai04310  Wnt signaling pathway
eai04340  Hedgehog signaling pathway
eai04371  Apelin signaling pathway
eai04530  Tight junction
eai04540  Gap junction
eai04611  Platelet activation
eai04713  Circadian entrainment
eai04714  Thermogenesis
eai04720  Long-term potentiation
eai04723  Retrograde endocannabinoid signaling
eai04724  Glutamatergic synapse
eai04725  Cholinergic synapse
eai04726  Serotonergic synapse
eai04727  GABAergic synapse
eai04728  Dopaminergic synapse
eai04740  Olfactory transduction
eai04742  Taste transduction
eai04750  Inflammatory mediator regulation of TRP channels
eai04910  Insulin signaling pathway
eai04911  Insulin secretion
eai04912  GnRH signaling pathway
eai04913  Ovarian steroidogenesis
eai04914  Progesterone-mediated oocyte maturation
eai04915  Estrogen signaling pathway
eai04916  Melanogenesis
eai04918  Thyroid hormone synthesis
eai04919  Thyroid hormone signaling pathway
eai04921  Oxytocin signaling pathway
eai04922  Glucagon signaling pathway
eai04923  Regulation of lipolysis in adipocytes
eai04924  Renin secretion
eai04925  Aldosterone synthesis and secretion
eai04926  Relaxin signaling pathway
eai04927  Cortisol synthesis and secretion
eai04928  Parathyroid hormone synthesis, secretion and action
eai04934  Cushing syndrome
eai04961  Endocrine and other factor-regulated calcium reabsorption
eai04962  Vasopressin-regulated water reabsorption
eai04970  Salivary secretion
eai04971  Gastric acid secretion
eai04976  Bile secretion
eai05012  Parkinson disease
eai05020  Prion diseases
eai05030  Cocaine addiction
eai05031  Amphetamine addiction
eai05032  Morphine addiction
eai05146  Amoebiasis
eai05163  Human cytomegalovirus infection
eai05165  Human papillomavirus infection
eai05166  Human T-cell leukemia virus 1 infection
eai05200  Pathways in cancer
eai05203  Viral carcinogenesis
eai05205  Proteoglycans in cancer
eai05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    106844316 (PRKACA)
   04010 MAPK signaling pathway
    106844316 (PRKACA)
   04310 Wnt signaling pathway
    106844316 (PRKACA)
   04340 Hedgehog signaling pathway
    106844316 (PRKACA)
   04371 Apelin signaling pathway
    106844316 (PRKACA)
   04020 Calcium signaling pathway
    106844316 (PRKACA)
   04024 cAMP signaling pathway
    106844316 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106844316 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    106844316 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    106844316 (PRKACA)
   04540 Gap junction
    106844316 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    106844316 (PRKACA)
   04062 Chemokine signaling pathway
    106844316 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    106844316 (PRKACA)
   04910 Insulin signaling pathway
    106844316 (PRKACA)
   04922 Glucagon signaling pathway
    106844316 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    106844316 (PRKACA)
   04912 GnRH signaling pathway
    106844316 (PRKACA)
   04913 Ovarian steroidogenesis
    106844316 (PRKACA)
   04915 Estrogen signaling pathway
    106844316 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    106844316 (PRKACA)
   04921 Oxytocin signaling pathway
    106844316 (PRKACA)
   04926 Relaxin signaling pathway
    106844316 (PRKACA)
   04918 Thyroid hormone synthesis
    106844316 (PRKACA)
   04919 Thyroid hormone signaling pathway
    106844316 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    106844316 (PRKACA)
   04916 Melanogenesis
    106844316 (PRKACA)
   04924 Renin secretion
    106844316 (PRKACA)
   04925 Aldosterone synthesis and secretion
    106844316 (PRKACA)
   04927 Cortisol synthesis and secretion
    106844316 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    106844316 (PRKACA)
   04270 Vascular smooth muscle contraction
    106844316 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    106844316 (PRKACA)
   04971 Gastric acid secretion
    106844316 (PRKACA)
   04976 Bile secretion
    106844316 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    106844316 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    106844316 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    106844316 (PRKACA)
   04727 GABAergic synapse
    106844316 (PRKACA)
   04725 Cholinergic synapse
    106844316 (PRKACA)
   04728 Dopaminergic synapse
    106844316 (PRKACA)
   04726 Serotonergic synapse
    106844316 (PRKACA)
   04720 Long-term potentiation
    106844316 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    106844316 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    106844316 (PRKACA)
   04742 Taste transduction
    106844316 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    106844316 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    106844316 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    106844316 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    106844316 (PRKACA)
   04714 Thermogenesis
    106844316 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106844316 (PRKACA)
   05205 Proteoglycans in cancer
    106844316 (PRKACA)
   05203 Viral carcinogenesis
    106844316 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    106844316 (PRKACA)
   05020 Prion diseases
    106844316 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    106844316 (PRKACA)
   05031 Amphetamine addiction
    106844316 (PRKACA)
   05032 Morphine addiction
    106844316 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy (DCM)
    106844316 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    106844316 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    106844316 (PRKACA)
   05163 Human cytomegalovirus infection
    106844316 (PRKACA)
   05165 Human papillomavirus infection
    106844316 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106844316 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    106844316 (PRKACA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:eai01001]
    106844316 (PRKACA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:eai03019]
    106844316 (PRKACA)
   03036 Chromosome and associated proteins [BR:eai03036]
    106844316 (PRKACA)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     106844316 (PRKACA)
Protein kinases [BR:eai01001]
 Serine/threonine kinases: AGC group
  PKA family
   106844316 (PRKACA)
Messenger RNA biogenesis [BR:eai03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     106844316 (PRKACA)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106844316 (PRKACA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 106844316
NCBI-ProteinID: XP_014717179
LinkDB All DBs
Position
Un
AA seq 359 aa AA seqDB search
MGPDHPIPLHPPLHPLPEEAGSRVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGT
GSFGRVMLVKHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFK
DNSNLYMIMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPEN
LLIDQHGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKXXXXXXXXXALGVLIYEM
AAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDI
KNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgggcccagatcaccccatcccactccaccccccactgcaccctctgccagaagaggca
ggaagcagagtgaaagagttcttagctaaagccaaagaagattttcttaaaaaatgggaa
aatcctgctcagaatacagcccatttggatcagtttgaacgaatcaagacccttggcacg
ggctccttcgggcgggtgatgctcgtgaagcacaaggagacggggaaccacttcgccatg
aagatcctcgacaaacagaaggtggtgaagctgaaacagatcgagcacaccctgaacgaa
aagcgcatcttgcaagccgtcaacttcccgttcctcgtcaaactcgagttctccttcaag
gacaactcgaatctgtacatgatcatggagtacgtgcctggcggggagatgttctcacac
ctgcggcggatcggaaggttcagtgagccccatgcccgcttctatgcggcccagatcgtg
ttgaccttcgagtacctgcactcgctcgacctcatctaccgggacctgaagccggagaac
ctgctcatcgaccagcatggctacatccaggtgacagacttcggtttcgccaagcgcgtg
aaaggccgcacctggaccttgtgtgggacccccgagtacctggccccggaaatcatcctg
agcaaannnnnnnnnnnnnnnnnnnnnnnnnnngccctgggggttctcatctacgagatg
gccgctggctacccacccttctttgccgaccagcccatccagatctacgagaagattgtc
tccgggaaggtgcggttcccgtcccacttcagctctgacctgaaggatctgctgcggaac
ctcctgcaggtggacctcaccaagcgcttcgggaacctcaagaatggggtcaatgatatc
aagaaccacaagtggtttgccacgactgactggatcgccatctaccagaggaaggtggaa
gctcccttcataccaaagtttaaaggccctggggacacgagtaactttgacgactatgag
gaggaagagatccgagtctccatcaatgagaagtgtggcaaggagttctccgagttttag

DBGET integrated database retrieval system