KEGG   Equus asinus (ass): 106844596
Entry
106844596         CDS       T04645                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
eai  Equus asinus (ass)
Pathway
eai00220  Arginine biosynthesis
eai00330  Arginine and proline metabolism
eai01100  Metabolic pathways
eai04020  Calcium signaling pathway
eai04066  HIF-1 signaling pathway
eai04146  Peroxisome
eai04371  Apelin signaling pathway
eai04926  Relaxin signaling pathway
eai05010  Alzheimer disease
eai05014  Amyotrophic lateral sclerosis
eai05022  Pathways of neurodegeneration - multiple diseases
eai05133  Pertussis
eai05140  Leishmaniasis
eai05142  Chagas disease
eai05145  Toxoplasmosis
eai05146  Amoebiasis
eai05152  Tuberculosis
eai05200  Pathways in cancer
eai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    106844596 (NOS2)
   00330 Arginine and proline metabolism
    106844596 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    106844596 (NOS2)
   04066 HIF-1 signaling pathway
    106844596 (NOS2)
   04020 Calcium signaling pathway
    106844596 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106844596 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    106844596 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    106844596 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    106844596 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    106844596 (NOS2)
   05014 Amyotrophic lateral sclerosis
    106844596 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    106844596 (NOS2)
   05152 Tuberculosis
    106844596 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    106844596 (NOS2)
   05145 Toxoplasmosis
    106844596 (NOS2)
   05140 Leishmaniasis
    106844596 (NOS2)
   05142 Chagas disease
    106844596 (NOS2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     106844596 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 106844596
NCBI-ProteinID: XP_014717612
LinkDB
Position
Un
AA seq 1200 aa
MKPNPVRLSGSLRPGVGAAGSGGDKAAGAARGARRPWSSACAGAMREGLGAACEAAWPRL
CRLLRRILRPQSTCGRRRASSVTQDDPKGHSLGKHRNESLQPVTGMAKKSPESLVKLDVP
PSACPRHVRIKNWGNGMTFEDMLHREANGEVACKSKSCLAAVMNPKSMTRGPRDKPTPPD
ELLPHAIQFVNQYYNSFKEAKIEEHLARLEAVTKEIETTGTYQLTGDELIFATKQAWRNA
PRCIGRIQWSNLQVFDARSCSTAQEMFEHICRHLRYSTNNGNIRSAITVFPQRSDGKHDF
RIWNAQLIRYAGYQMPDGTIRGDPASVELTQLCIDLGWKPKYGRFDVMPLVLQADGRDPE
LFEIPPDLVLEVPMEHPKYEWFQELGLKWYALPAVANMLLEVGGLEFPGCPFNGWYMGTE
IGVRDYCDAQRYNILEEVGRRMGLETHKLASLWKDRAVIEINVAVLHSFQKQNVTIMDHH
SAAESFMKHMQNEYRSRGGCPADWVWLVPPISGSITPVFHQEMLNYVLSPFYYYQVEAWK
THVWQDEKQSPRRRQIRFKVLVKAVLFASMLMRKTMASRVRATILFATETGKSETLARDL
GTLFSCAFNPKVLCMDEYQLRYLEQEQLLLVVTSTFGNGDSPGNGEKLKKSLFMLKKLTN
KFRYAVFGLGSSMYPQFCAFAHDIDQKLSHLGASQLTPTGEGDELGGQEDAFRSWAVQTF
KTACETFNVRGKHQIQIPKLYTSNETWDPHHYRLVQDPQPLDLSKALSSMHAKNVFTMRL
KSRQNLQSPKSSRTTLLIELSSEASQGLSYLPGEHLGVFPGNQPALVQGILERVEDGPAP
DQPVRLETLDESGSYWVKDKRLPPCSLIQALTYFLDITTPPTQQLLRKLAQLATKEAERQ
RLETLCQPSEYNKWKLTNSPSFLEVLEEFPSLRVSAGFLLSQLPILKPRYYSISSSRDCT
PMEVHLTVAVLTYRTRDGQGPLHHGVCSTWLSSLKPQDPVPCFVRSATGFRLPENPSHPC
ILVGPGTGIAPFRSFWLQRLHDAENRGLQGGRMTLVFGCRHPDEDHLYQEEMLEMARKGV
LHEVHTAYSRLPGQPKVYVQDILRQQLVSEVLRVLHEEQGHIYVCGDVRMARDVAHTLKQ
LVAAKLSLSEEQVEDYFFQLKSQKRYHEDIFGAAVPYKLRKDGAAGQPSHPRAPSAPRKS
NT seq 3603 nt   +upstreamnt  +downstreamnt
atgaagccgaatccagtccgcctctctggctcgctccgccccggggtgggggctgcgggg
tccggcggcgataaagcggccggcgcggcgcgcggagcgaggcgcccttggagcagcgcc
tgcgccggggccatgcgcgagggcctgggcgcggcgtgtgaggccgcctggccccgactc
tgccggctcctccgtagaatcctccggccacagagcacctgcggtcgccgccgagccagt
tcagtgacacaggatgaccccaagggtcacagcctcggcaagcacaggaatgagtccctg
cagcccgtcaccggaatggcaaagaagtctccagaatccctggtcaagctggatgtgccc
ccctcggcctgcccacggcatgtgaggatcaaaaactggggtaacgggatgactttcgag
gacatgcttcaccgcgaggccaatggggaggtcgcttgcaagtccaagtcttgcctggca
gccgtcatgaaccccaaaagtatgaccagagggcccagggacaagcctacacccccagat
gagcttctacctcacgctatccaatttgtcaaccagtattacaactccttcaaagaagca
aaaatagaggaacatctggccaggctggaagccgtaacaaaggagatagaaacaacagga
acctaccagctgacgggagatgagctcatctttgccaccaagcaggcctggcgcaatgcc
ccccgctgcatcgggaggatccagtggtccaacctacaggtctttgatgcccggagctgt
tctactgcccaggaaatgttcgaacacatctgcagacacctgcgttactccaccaacaat
ggcaacatcaggtcggccatcaccgtgttcccccagcggagtgatggaaagcatgacttc
cggatctggaatgctcagctcatccggtatgccgggtaccagatgcctgatggcaccatc
agaggggaccctgcctctgtggagttaacccagctgtgcatcgacctgggctggaagccc
aagtacggccgctttgatgtgatgcctctggtcctgcaggctgatggccgcgaccctgag
ctctttgaaatccctcctgaccttgtgctcgaggtgcccatggaacatcccaagtacgag
tggttccaggagctggggctgaagtggtacgcactgccggcagtagccaacatgctgctt
gaggtgggcggcctggagttcccagggtgccccttcaacggctggtacatgggcacggag
atcggggtccgagactactgtgatgcccagcgctacaacatcttggaggaagtgggcaga
aggatgggcctagaaacacacaagctggcctccctctggaaggaccgggctgtcatcgag
atcaacgtggctgtgctccacagtttccagaagcaaaatgtgaccatcatggaccaccac
tcagctgcagagtccttcatgaagcacatgcagaatgagtaccggtcccgtgggggctgc
ccggccgactgggtttggctggtacccccgatttctgggagcatcacccccgtgttccac
caggagatgttaaactatgtcctgtcccctttctactactaccaggtggaggcctggaaa
acccacgtctggcaggatgagaagcagagcccccggagaagacagattcgattcaaggtc
ttggttaaagccgtgctctttgcctccatgctgatgcgcaagaccatggcgtcccgagtc
agagccacaatcctctttgccacggagacgggaaaatcggaaacgctggcccgggacctg
gggactttgttcagttgtgctttcaaccccaaggttctctgtatggacgagtaccagctg
agatacctagaacaggagcagcttctgctggtggtgaccagcacgtttgggaacggagac
tcccccggcaacggagagaaattgaagaaatccctcttcatgctgaaaaagctcacgaac
aagttcaggtatgctgtgtttggccttggctccagcatgtaccctcagttctgtgccttc
gctcatgacatcgaccagaagttgtctcacctgggggcctcgcagctcacccccacaggg
gaaggggatgagctcggtggccaggaggatgccttccgcagctgggccgtgcaaaccttc
aagacagcctgtgagacgttcaacgtccgaggcaaacaccaaattcagatccccaagctc
tacacctccaatgagacctgggacccacatcactacaggctcgtgcaggacccgcagcct
ttggacctcagcaaagccctcagcagtatgcacgccaagaatgtgttcaccatgaggctc
aaatcgcggcagaatctacagagtccgaagtccagccgcaccaccctcctgatagaactc
tccagtgaggccagccaaggtctgagctacctgccaggggagcatctgggggttttccca
ggcaaccagccagctctggtccaaggtatcttggagcgagtggaggatggccctgcaccc
gaccaacccgtgcgcctggagacccttgatgagagcggcagctactgggtcaaggacaag
cggctgcccccctgctcactcatccaggcactcacctatttcctggacatcaccacaccc
ccaacccaacagcttctccgaaagctggcccagctggccaccaaagaggctgagaggcag
agactggagaccctgtgccagccctcagagtacaacaagtggaagttgaccaacagcccc
tcattcctggaggtgttggaggagttcccatccctgcgggtgtctgctggcttcctgctc
tcccagctccctattctgaaaccccggtactactccatcagctcctccagggactgcaca
cccatggaggtccacctcactgtggctgtgctcacgtaccgcacccgagatggtcagggt
cccctgcatcatggtgtctgcagcacatggctcagcagcctgaagccccaagacccagtg
ccctgctttgtgcgaagtgccactggcttccggctccctgagaacccgtctcatccttgc
atcctcgtcgggcctggcacaggcattgcccccttccgcagtttctggctgcagcggctc
catgatgccgagaacagagggctccaaggtggccgcatgaccctggtgttcgggtgccgc
cacccagatgaggaccacctctatcaggaggagatgctggagatggcccggaaaggggtg
ctgcatgaggtgcacacggcctattctcgcctccctggacagcccaaggtctatgttcaa
gacatcctgcggcagcaactggtcagcgaggtgctccgtgtgctccatgaggaacaaggc
cacatctatgtctgtggggacgtgcgcatggcccgggacgtggcccacaccctgaagcag
ctggtggctgccaagttgagcctgagtgaggagcaggtcgaggactatttcttccagctt
aagagccagaagcgctaccatgaagacatctttggtgctgcagttccctacaagctgaga
aaggatggggccgcagggcagcccagccatcccagagcgccatcagcccccaggaaaagt
taa

DBGET integrated database retrieval system