KEGG   Equus asinus (ass): 106844752Help
Entry
106844752         CDS       T04645                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00730  Thiamine metabolism
eai00790  Folate biosynthesis
eai01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    106844752
   00790 Folate biosynthesis
    106844752
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106844752
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eai00537]
    106844752
Enzymes [BR:eai01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     106844752
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106844752
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:eai00537]
 Enzymes
  106844752
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme DUF2689
Motif
Other DBs
NCBI-GeneID: 106844752
NCBI-ProteinID: XP_014717880
LinkDB All DBs
Position
Un
AA seq 564 aa AA seqDB search
MRGAWVLLLLLGLRLRLSLGVIPVEEEDPAFWNRQAAQALDTAKKLQPIQTAAKNLIIFL
GDGMGVPTVTATRILKAQMDGKLGPETPLAMDHFPYLALSKTYNVDRQVPDSAGTATAYL
CGVKANYQTIGVSAAARYNQCNTTRGNEVTSVMNRAKKAGKSVGVVTTTRVQHASPAGTY
AHTVNRSWYSDAEMPDEALNDGCQDIARQLISNMDIDVILGGGRKYMFPKGTPDPEYPND
ASQNGTRVDQRNLVQEWLAKYQGAQYVWNRTALIQASQDPSVTHLMGLFEPEDMQYEAHR
DLTLDPSLTEMTEAALRVLSRNPSGFYLFVEGGRIDHGHHAGTAYLALTEATMFDDAIDK
ASQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSILGLAPSKASDGKAYTSILYGNGPGYV
LSGGSRPDVNESQSSKYSGSAVWGGPWWELELVGGGRXXXXXXXETHGGEEAAVFARGPQ
AHLVHGVQEQTXVAHVMSFVTCLEPYTACDLSPPATSTDSVSPRPTESTHPGPTDAALPG
PAAGPPSLPLLAGRCCCCCCCCCC
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgcggggagcctgggtgctgttgctgctgctgggcctgaggttacggctctcccttggg
gtcatcccagttgaggaagaggacccggccttctggaaccgccaggcagcccaagccctg
gacaccgctaagaagctgcagcccatccagacggccgccaagaacctcattatcttcttg
ggggacgggatgggggtgcccacggtgacagccactcggatactgaaggcacagatggat
ggcaagctgggacccgagacgcccctggccatggaccacttcccctacctggctctgtcc
aagacatacaacgtggacagacaggtgccggacagcgcaggcacagccacggcctacctg
tgcggggtcaaggccaactaccagaccatcggtgtgagtgcggccgcccgctataaccag
tgcaacacgacgcgtggcaatgaggtcacctccgtgatgaatcgagccaagaaagcaggg
aagtcagtgggggtggtgaccaccaccagggtacagcatgcatcgccagctggcacctac
gcgcacacggtgaaccgcagttggtactcagacgctgaaatgcctgacgaggctctgaac
gacggctgccaggatattgccaggcagctcatctccaacatggacattgatgtgatcctg
ggcggaggccgcaagtacatgtttcccaaggggaccccagaccctgagtatccgaatgat
gccagccagaacggaaccagggtggaccagcggaacctggtgcaggagtggctggccaag
taccagggtgcccagtatgtgtggaaccgcacggcgctcatccaggcgtcccaggacccc
tctgtgacacatctcatgggcctctttgagccagaggacatgcaatatgaggcccatcga
gacctcaccctggacccatccctgacggagatgaccgaggcggccctgcgtgtgctgagc
aggaaccccagtggcttctacctcttcgtggaggggggccgcatcgaccatggtcaccat
gctggaaccgcttacctggcactgaccgaggccaccatgttcgatgatgccattgacaaa
gccagccagctcacaagtgaggaggacacactgacccttgtcaccgctgaccactctcac
gtcttctcttttggtggctacacactgcgtgggagctccattttagggctggcccccagc
aaggcctccgatggcaaggcctacacctccatcctgtatggcaatggcccaggctatgtg
ctcagtggtggttcccggcctgacgtcaacgagagccagagcagtaagtacagcgggtcg
gcagtctggggtggaccatggtgggaactcgaactcgtgggaggggggaggnnnnnnnnn
nnnnnnnnnnnggagacccacggcggcgaggaggcggcggtgttcgcgcgcggcccgcag
gcgcacctggtgcacggcgtgcaggagcagaccntcgtggcgcacgtcatgtccttcgtc
acgtgcctcgagccctacacagcctgcgacctgtcgccccccgccacctccaccgacagc
gtgagtcctcggcccacagagagcacgcatcccggccccaccgatgccgcgctccccggg
cccgccgctgggccgccgtccctgccgctgctggccgggcgctgctgctgctgctgctgc
tgctgctgctgctag

DBGET integrated database retrieval system