KEGG   Equus asinus (ass): 106845014Help
Entry
106845014         CDS       T04645                                 

Gene name
HKDC1
Definition
(RefSeq) hexokinase domain containing 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00010  Glycolysis / Gluconeogenesis
eai00051  Fructose and mannose metabolism
eai00052  Galactose metabolism
eai00500  Starch and sucrose metabolism
eai00520  Amino sugar and nucleotide sugar metabolism
eai00524  Neomycin, kanamycin and gentamicin biosynthesis
eai01100  Metabolic pathways
eai01200  Carbon metabolism
eai04066  HIF-1 signaling pathway
eai04910  Insulin signaling pathway
eai04930  Type II diabetes mellitus
eai04973  Carbohydrate digestion and absorption
eai05230  Central carbon metabolism in cancer
Module
eai_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eai_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106845014 (HKDC1)
   00051 Fructose and mannose metabolism
    106845014 (HKDC1)
   00052 Galactose metabolism
    106845014 (HKDC1)
   00500 Starch and sucrose metabolism
    106845014 (HKDC1)
   00520 Amino sugar and nucleotide sugar metabolism
    106845014 (HKDC1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106845014 (HKDC1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    106845014 (HKDC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    106845014 (HKDC1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    106845014 (HKDC1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    106845014 (HKDC1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    106845014 (HKDC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eai04131]
    106845014 (HKDC1)
Enzymes [BR:eai01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106845014 (HKDC1)
Membrane trafficking [BR:eai04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106845014 (HKDC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 106845014
NCBI-ProteinID: XP_014718286
LinkDB All DBs
Position
Un
AA seq 916 aa AA seqDB search
MFAVHLMAFYFTKLKEDQIKKVDRFLYHMRLSDETLLDIMARFQAEMQKGLGKDTNPTAS
VKMLPTFVRAIPDGSENGEFLSLDLGGSKFRVLKVQVSEEGKRNVQMESQFYPTPNEIIR
GNGIELFEYVADCLADFMNTKGLKHKRLPLGLTFSFPCRQTKLEEGVLLSWTKKFKARGV
QDTDVVSCLTRAMKRHKDINVDTLALVNDTVGTMMTCAYDDPYCEVGVIIGTGTNACYME
DMSNIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDRELDLGSLNPGKQLFEKMISGL
YLGELVRLILLKMAKAGLLFGGEKSSALHTKGKIETRHVAAMEKYKEGLANTREILTDLG
LEPSEADCIAVQHVCTIVSFRSANLCAAALAAILTRLRENKKLVRLRTTVGMDGTLYKIH
PQYPKRLHKVVRRLVPNCDVRFLLSESGSAKGAAMVTAVASRVQAQRKQIDLVLALFRLT
QEQLVGVQDKMRAELEYGLKRDTHSLATVKMLPTYVCGMPDGTEKGKFLALDLGGTNFRV
LLVKIRSGRRSVRMYNKIFAIPLEIMQGTGEELFDHIVQCIADFLDYMGLKGAQLPLGFT
FSFPCRQASIDKGTLIGWTKGFKATDCEGEDVVDMLREAIKRRNEFDLDIVAVVNDTVGT
MMTCGYEDPNCEIGLIAGTGSNLCYMEEMRNIELVEGDEGKMCINTEWGGFGDNGCIDDI
RTQYDKEVDEGSLNPGKQRYEKMTSGMYLGEIVRQILIDLTKQGLLFRGQISERLRTRGI
FETKFLSQIESDRLALLQVRRILQQLGLDSTCEDSIVVKEVCGAVSRRAAQLCGAGLAAI
VEKRREDQGLERLRITVGVDGTLYKLHPHFSRILQETVKELAPRCDVTFMLSEDGSGKGA
ALITAVAKRLQQAWKN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcggtacacttgatggcattttacttcaccaagctgaaggaggatcagatcaag
aaggtggacagattcctgtatcacatgcggctctccgatgagacccttttggacatcatg
gctcggttccaggctgaaatgcagaaggggctggggaaggacaccaaccccacagcctca
gtgaagatgctgcccacctttgtcagggccattccagatggctcagaaaatggggagttt
ctttccctggatcttggaggatccaagtttcgagtcttgaaggtgcaagtctctgaagag
gggaaacgaaacgtccagatggaaagtcagttctacccaacacccaatgaaattatccga
gggaatggcatcgagctgtttgagtacgtagctgactgtctggcagacttcatgaacacc
aaaggattgaagcataagaggttgcccctcggcctaaccttttcttttccctgcaggcag
actaaactggaagagggtgtcctgctttcatggacgaagaagtttaaggcacggggagtt
caggacacagatgtagtgagctgtctgaccagggctatgaaaagacacaaggacatcaat
gtggacaccctggccttggtcaatgacactgtggggaccatgatgacgtgcgcctatgac
gatccctactgcgaagttggtgtcatcattggcactggcaccaacgcgtgttacatggag
gacatgagcaacatagacctggtggaaggtgacgagggcaggatgtgcatcaacacagag
tggggggcctttggggacgacggggccctggaagacatccgcaccgagttcgaccgggag
ttggacctcggctctctcaaccccgggaagcaactgtttgagaagatgatcagtggcctg
tacctgggtgaactcgtcaggctcatcttgctgaagatggccaaggcaggcctcttgttt
ggtggtgagaaatcctctgctctccacactaagggcaagattgaaacacggcacgtggct
gccatggaaaagtataaagaaggccttgccaatacaagagagatcctgacggatctgggc
cttgagccttcggaggccgactgcattgcggtccagcacgtctgcaccatcgtctccttc
cgctcagccaatctctgtgcagcggccctggcagccatcctgacgcgcctccgggagaac
aagaagctggtgcggctccggaccacggtgggcatggacggcacactgtacaagatacac
cctcaatacccgaaacgcctgcacaaggtggtgaggagactggtcccgaattgtgacgtc
cgcttcctcctgtcagagagtggcagcgccaagggggctgccatggtgacagcggtggcc
tcccgagtgcaggctcagcggaagcagattgacctggtgctggctttgttccggctgacg
caagagcagcttgtgggtgtgcaggacaagatgcgggctgagctcgagtatgggctgaag
agggacacccactccctggccacagtcaagatgctgcccacctacgtctgtgggatgccg
gatggcacagagaaaggaaagttccttgccctggatctggggggaaccaacttccgggtc
cttctggtgaagatcagaagtggacggaggtcggtgcgaatgtacaataagatcttcgcc
atccccctggagattatgcagggcaccggcgaggagctctttgaccacattgtgcagtgc
atcgcggacttcctggactacatgggcctcaagggagcccagctgcctttgggcttcacc
ttctcgtttccctgcaggcaggcgagcattgacaagggaacactcattgggtggaccaaa
ggcttcaaggccactgactgtgaaggagaagatgtagtggacatgctcagggaagctatc
aagaggagaaacgaatttgacctggacatagttgcagtcgtgaatgacacagtggggacc
atgatgacctgtggctatgaagatcctaattgtgagattggcctgattgcgggaacaggc
agcaacctatgctacatggaggagatgaggaacatcgaactggtagaaggggacgaaggg
aagatgtgcattaacacagagtggggaggatttggagataatggctgtatagacgacatc
cggacccaatatgacaaggaggtggacgaggggtccttgaatcctggcaaacagagatat
gagaaaatgaccagtgggatgtatctgggagagatcgtgcggcagatcctgattgacctg
accaagcagggtcttctcttccgtgggcagatttcagagcgtctccgaaccagaggcatc
tttgaaaccaagttcctgtcgcagatcgaaagtgatcggctggccctcctccaggtcagg
aggatcctgcagcagctcggcctggacagcacgtgtgaggacagcattgtggtgaaggag
gtgtgcggagctgtgtcccggcgggcggcccagctctgtggcgctggcttggccgccatt
gtagagaaaaggagggaagaccaggggctcgagcgcctgaggatcaccgtgggcgtggac
ggcaccctgtacaagctgcacccgcacttttctcggatattgcaggaaactgtgaaagaa
ctagcccctcgatgtgatgtgacattcatgctgtcagaagatggaagtggaaagggagca
gctctgatcactgctgtggccaagagattacagcaggcatggaagaactag

DBGET integrated database retrieval system