KEGG   Equus asinus (ass): 106845535Help
Entry
106845535         CDS       T04645                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
eai  Equus asinus (ass)
Pathway
eai00052  Galactose metabolism
eai00500  Starch and sucrose metabolism
eai01100  Metabolic pathways
eai04142  Lysosome
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106845535 (GAA)
   00500 Starch and sucrose metabolism
    106845535 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106845535 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eai04147]
    106845535 (GAA)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106845535 (GAA)
Exosome [BR:eai04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106845535 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106845535
NCBI-ProteinID: XP_014719265
LinkDB All DBs
Position
Un
AA seq 940 aa AA seqDB search
MDERRLPCSRPLGLCVLVCLATTALLGHVLLHDFTMVPRELHGFSQVPKEIYRAPQQGAS
GSARAAPAQCDTPPDSRFDCAPDKAITQEQCEARGCCYVPARRQPPGSQMGQPWCFFPPS
YPSYKLGNLTTTETGYTATLTRAAPTFFPKDILTLRLDVLVETESRLHFTIKDPANRRYE
VPLETPCVRSRATSTLYSVEFSEEPFGVVVRRKLNGRVLLNTTVAPLFFADQFLQLSTSL
PSRYVTGLAEHLGPLMLNTNWTKITLWNRDIAPTPSVNLYGSHPFYMVLEDGGSAHGVFL
LNSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLEVVGYPFMPPYWGLGFH
LCRWGYSSTAITRQVVENMTRAHFPLDVQWNDLDYMDARRDFTFNKDGFGDFPAMVQELH
QGGRRYMMIVDPAISSSGPPGSYRPYDEGLRRGVFITNETGQPLIGKVWPGSTAFPDFTN
PEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSVDGCPDSDLENPPYVPGVVGGTL
RAATICASSQQFLSTHYNLHNLYGLTEAIASHRALVKARGVRPFVISRSTFAGHGRYAGH
WTGDVWSSWEQLSYSVPEILLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMR
NHNGLDSLPQEPYRFSETAQQAMRKAFALRYVLLPHLYTLFHGAHTRGQTVARPLFLEFP
EDPRTWTVDRQLLWGEALLITPVLEAGKVEVTGYFPLGTWYDLQTVPVGALGGLPSPAPA
PLTPAIHSEGQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRKQPTALVVALTSSRE
AQGELFWDDGESLGVLEREAYTHIIFLARNNTIMNELLHVTSEGASLQLERVTVLGVAAA
PQQVLSNGVPVSNFTYNPDTKTLDIPVSLTMGEQFLISWS
NT seq 2823 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaggcggctgccctgctcccgccccctggggctctgtgtcctcgtctgcttg
gccaccactgccctcctggggcatgtcctgctgcacgatttcacgatggtcccccgagag
ctgcatggcttctctcaagtacccaaggagatttaccgagctccccagcagggagccagc
ggcagtgccagagcagcgccggcacagtgcgacacgccccccgacagccgcttcgactgt
gcaccagacaaggccatcacccaggagcagtgtgaggcccggggctgctgctacgtgcct
gccaggcggcagcctccgggctcccagatggggcagccctggtgcttcttcccccccagc
tacccgagttacaagctggggaacctgaccaccaccgagacgggctacaccgccaccctc
actcgagccgccccgaccttcttccccaaggacatcctgaccttacggctggacgtgctc
gtggagaccgagagtcgactccactttacgatcaaagaccccgccaacaggcgctacgag
gtgcccctggagaccccgtgcgtccgcagccgggcaacgtccactctctacagcgtggag
ttctcggaggagcccttcggggtggtcgtgcgccggaagctgaacggacgggtgctgctg
aacacgacggtggcgcccctgttcttcgccgaccagtttctgcagctgtccacctccctg
ccatcccggtacgtcaccggccttgccgagcaccttggccccctgatgctcaacaccaac
tggaccaagatcaccctctggaaccgggacatcgcccccacgccctccgtgaacctctac
gggtcccaccctttctacatggtgctggaggacggcgggtcggctcacggggtcttcctc
ctgaacagcaatgccatggatgtggtcctgcagcctagcccggccctcagctggaggtca
actggcgggatcctggacgtgtacgtcttcctgggcccggagcccaagagcgtggtgcag
cagtacctggaagtcgtgggctacccattcatgccgccgtactggggcctgggtttccac
ctctgccgctggggctactcctccaccgccatcacccgccaggtcgtggagaacatgacc
agggcccacttccccctcgacgtccagtggaacgacctggactacatggacgccaggagg
gacttcactttcaataaggatggcttcggggacttcccggccatggtgcaggagctccac
cagggcggccggcggtacatgatgatcgttgaccccgccatcagcagttctggccccccc
gggagctaccgaccctatgacgagggtctgcggaggggggttttcatcaccaatgagact
gggcagccgctgattgggaaggtgtggcccgggtccaccgccttccccgacttcaccaac
cctgaggcccttgactggtggcaggacatggtggccgagttccacgcccaggtgcccttt
gacggcatgtggattgacatgaatgagccgtccaacttcgtaaagggctctgtggacggc
tgccccgacagtgacctggagaacccgccctatgtgccaggggtggttggcgggaccctc
cgggcagccaccatctgtgcctccagccagcagttcctctccacgcactacaacctgcac
aacctgtacggcctgactgaagccatcgcctcccacagggccctggtgaaggctcggggg
gtgcgccccttcgtgatttcccgctcaaccttcgctggccacggccgatacgccggccac
tggacaggggatgtgtggagcagctgggagcagctctcctactctgtgccagaaatcctg
ctcttcaacctgctgggggtgccgctggtcggggccgacatctgtggcttcctgggcaac
acctcggaggagctgtgcgtgcgctggacccagctgggggccttctaccccttcatgcgg
aaccacaacggcctggacagcctgcctcaggagccgtacaggttcagtgagacggcgcag
caagccatgaggaaggccttcgccctgcgctacgtgctgctgccccacctctacacgctg
ttccacggggcacacaccaggggccagactgtggcccggcccctcttcctggagttccct
gaggacccccgcacctggaccgtggaccgccagctcctgtggggggaggccctgctcatc
accccagtgctcgaggccgggaaggtcgaagtgactggctactttccgctcggcacgtgg
tacgacctgcagacggtgccagtaggggcccttggtggcctcccctctccagcgcctgca
cccctcacgcctgccatccacagtgaagggcagtgggtgacactgccagccccactggac
accatcaacctccacctccgggctgggcacatcatccccctgcagggccccggcctcaca
accacagagtcccgcaagcagcccacggccctggttgtggccctgacctcgagtcgggag
gcccagggggagctgttctgggatgacggcgagagcctgggagtgctggagcgcgaggcc
tacacccacatcatcttcctggccaggaacaacaccatcatgaacgaactgttgcatgtg
accagtgagggggccagcctgcagctggagagggtgactgtcctgggggtggccgcggcc
ccccagcaagtcctctccaatggtgttcctgtctccaacttcacctacaaccctgacacc
aagaccctggacatccctgtctcgctgaccatgggagagcagtttctcatcagttggtct
taa

DBGET integrated database retrieval system