KEGG   Equus asinus (ass): 106845881
Entry
106845881         CDS       T04645                                 

Gene name
ZBTB49
Definition
(RefSeq) zinc finger and BTB domain containing 49
Organism
eai  Equus asinus (ass)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_6 zf-met GAGA zf-C2H2_11 Zn-ribbon_8 zf-C2H2_3rep zf-H2C2_5 zf-C2HC_2
Other DBs
NCBI-GeneID: 106845881
NCBI-ProteinID: XP_014719820
LinkDB
Position
Un
AA seq 765 aa
MDPVATHSCHLLQQLHEQRIQGLLCDCMLVVKGVCFKAHKNVLAAFSQYFRSLFQNSSGQ
KNDVFHLDIKNVSGIGQILDFMYTSHLDLNQDNIQVMLDIAQCLQVQNVLNLCHTFLKSA
AVAQPSGMPCPSAFSLQGALTADAGCVMSESHPARLLQECSADLQHGKALDEPHSRAPPS
GHPPHSTSEASKEAPGTFDGSCTELPFKQPNCYYKLRNFYSKQYYKQATGPSHERTIEQP
FTLNTATDLGAIENQPCAVGHSECVLESAEHLPSNFLAQPLSESSADPVSDSTGQQPTKQ
MRLKKAIHLKKLNFLKSQESAERTSDPKSDDSLTKRIECAHENTVEKDSGQSPAEKESEA
LVNSEHFNCANEVERPEEPAALEDQSQTLQSQRQYACELCGKPFKHPSNLELHKRSHTGE
KPFECNICGKHFSQAGNLQTHLRRHSGEKPYICEICGKRFAASGDVQRHIIIHSGEKPHL
CDICGRGFSNFSNLKEHKKTHTADKVFTCDECGKSFNMQRKLVKHRIRHTGERPYSCSAC
GKCFGGSGDLRRHVRTHTGEKPYTCEICNKCFTRSAVLRRHKKMHCRADDEGQDALEEFT
QAIETSDLEKSQSSDSFSQDMAVTLMPVSVKLPVHPVEDSVTEFDSHSAGSYCKFRSMLQ
PHGGGDQEKLSLDPVKLGKPQMQQAPHQAYAYSDVDASASDEPLQADGMAMVRSSLAALD
NHCSDPLGSRVSATAYRNSEGQFFSSMTLWGLAMKTLQNENELEQ
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggacccagttgctactcacagctgccatctcctccagcaactgcacgagcagcgtatt
caaggcctgctgtgtgactgtatgttggtggtgaaaggagtctgctttaaagcacataag
aatgttctagcagccttcagtcagtattttaggagcctctttcagaattcctcaggccag
aagaatgatgtttttcacttggatattaaaaatgtaagcggcatcgggcagatcctggac
ttcatgtacacttctcatctagatcttaaccaagacaatatacaagtcatgctggacata
gcacagtgtttgcaagttcagaatgttctgaatctatgtcacacgtttttgaaatcagct
gccgtagcccagccgtctggcatgccttgtcccagtgccttctccctgcagggcgccttg
acggctgacgctggctgtgttatgagtgagagccaccctgctcgtttgctgcaggagtgc
tccgcagaccttcagcacggcaaagcgttggatgaaccgcattctcgcgctccaccgtca
ggtcatccacctcactcgacaagtgaagcgtctaaagaagcccctggtacttttgatggc
agctgcacagaactgcctttcaaacagccaaattgctactacaaactcaggaatttttac
agtaagcagtactataaacaagctactggtcccagtcacgagagaacaattgagcagcct
ttcaccctcaacacagccacagacctcggtgccatagaaaaccagccgtgtgctgttggt
cattccgaatgtgtcctggagtctgctgagcacttgccttccaacttcctggcccagcct
ttgagtgaatcttccgcagaccctgtgtcagacagcacaggccagcaacccaccaagcag
atgaggctcaaaaaggccattcacctgaagaagctcaatttcctaaagtcacaggaatct
gcagaacgcacgtctgaccccaagtcagatgacagcttaacaaagaggattgaatgtgct
catgaaaatactgtagagaaagatagcggccaaagtcctgcagaaaaagaaagtgaagca
ctcgtcaattctgagcattttaattgcgctaatgaagtggagaggccggaagagcctgcg
gcgctggaggaccagtcccagacgctccagtcccagagacagtatgcctgcgagttgtgt
gggaaacctttcaaacacccgagcaatttggagcttcacaaacggtctcacacaggtgag
aaaccttttgaatgtaacatttgtgggaaacatttctctcaggcaggtaacttgcagact
cacttacgtcggcattctggtgaaaaaccgtacatctgcgaaatctgtggaaagaggttt
gcagcctctggtgatgtccaacgtcacatcattattcactcaggagaaaagccacacttg
tgtgacatctgtggtcgaggatttagtaacttcagtaatttgaaggagcacaaaaagacg
cacacggctgataaagtgttcacctgcgatgaatgcggaaagtctttcaatatgcagagg
aagctggtgaagcacagaattcggcacacgggtgagcggccgtacagctgttctgcctgt
ggaaagtgtttcgggggttcaggtgacctccgcaggcacgtccgcactcacactggggag
aagccatacacgtgtgagatctgcaacaagtgcttcacacgctctgccgtgctacggcgg
cacaaaaagatgcactgcagagccgacgacgaggggcaggacgccctggaggagttcacg
caggccatcgagacctctgatctggagaagtctcagagctcagattctttttcccaagac
atggctgtgactttgatgcccgtgtctgtcaagctccctgtccacccagtggaagattca
gtgacagaatttgacagtcactctgccggctcctactgtaagttccgctcgatgctccag
cctcacggaggcggtgaccaggagaagctcagtttggatcctgttaaacttgggaagccc
cagatgcagcaggccccgcatcaggcgtacgcttactcggacgtggacgcctcagccagc
gacgagccgctgcaggccgacggcatggccatggtccgctcgtcgctggccgctttggac
aatcactgcagtgaccccctgggcagccgagtgtctgccacggcttacaggaactccgaa
gggcagttcttctccagcatgactctctgggggctggcgatgaagacgctgcagaatgaa
aacgagctggagcagtga

DBGET integrated database retrieval system