KEGG   Equus asinus (ass): 106846020
Entry
106846020         CDS       T04645                                 

Gene name
CPT1B
Definition
(RefSeq) carnitine palmitoyltransferase 1B
  KO
K19523  carnitine O-palmitoyltransferase 1, muscle isoform [EC:2.3.1.21]
Organism
eai  Equus asinus (ass)
Pathway
eai00071  Fatty acid degradation
eai01212  Fatty acid metabolism
eai03320  PPAR signaling pathway
eai04152  AMPK signaling pathway
eai04714  Thermogenesis
eai04920  Adipocytokine signaling pathway
eai04922  Glucagon signaling pathway
eai04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106846020 (CPT1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    106846020 (CPT1B)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    106846020 (CPT1B)
   04920 Adipocytokine signaling pathway
    106846020 (CPT1B)
   03320 PPAR signaling pathway
    106846020 (CPT1B)
  09159 Environmental adaptation
   04714 Thermogenesis
    106846020 (CPT1B)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    106846020 (CPT1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:eai03029]
    106846020 (CPT1B)
Enzymes [BR:eai01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     106846020 (CPT1B)
Mitochondrial biogenesis [BR:eai03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    106846020 (CPT1B)
SSDB
Motif
Pfam: Carn_acyltransf Synaptonemal_3 CPT_N DUF3128
Other DBs
NCBI-GeneID: 106846020
NCBI-ProteinID: XP_014720030
LinkDB
Position
Un
AA seq 833 aa
MAEAHQAVAFQFTVTPDGVDFQLSREALKHVYLSGINSWKKRLIRIKNGILRGVYPGSPT
SWLVVIMATVGSSYCNVDISMGLVSHIQRCLPEGCGPYQTPQTRALLSMAIFSTGVWMTG
IFFFRQTLKLLLSYHGWMFEMHGQTSHFTKVWAICVRLLSSRRPMLYSFQTSLPKLPVPS
VPATIQRYLESVRPLLDNEEYYRMEMLAKEFQDKTAPRLQKYLVLKSWWATNYVSDWWEE
YIYLRGRTPLVVNSNYYVMDFVLIKNTDVQAARLGNIVHAMIMYRRKLDREEIKPVMALG
MVPMCSYQMERMFNTTRIPGKKTDVLQHLSDSRHVAVYHKGRFFKVWLYEGSRLLKPRDL
EIQFQRILDDPSLPQPGEERLAALTAGGRVEWAQARQAFFGSGKNKASLDAIERAAFFVA
LDEESHHYDPEDEASLSLYGKALLHGNCYNRWFDKSFTLISFKNGHVGLNTEHAWADAPI
IGHLWEFVLGTDTFHLGYTEAGHCIGKSNSMLAPPQRLQWDIPDQCQAVIESSYQVAKAL
ADDVELYCFQFLPFGKGLIKKCRTSPDAFVQIALQLAHFRDRGRFCLTYEASMTRMFREG
RTETVRSCTSESTAFVQAMVEGTHMKAHLQNLFRKASEKHQNMYRLAMTGAGIDRHLFCL
YVVSKYLGVSSPFLAEVLSEPWRLSTSQIAQFQIRMFDPDQYPNHLGPGGGFGPVADDGY
GVSYMIAGENTIFFHVSSKFSSSETMADSDPGERNYDNMLKMLSDLNKDLEKLLEEMEKI
SVQATWMAYDMVVMRTNPTLAESMRRLEDAFLNCKEEMEKNWQELLSETTRKQ
NT seq 2502 nt   +upstreamnt  +downstreamnt
atggcggaagcacaccaagccgtggcctttcagttcacggtgaccccagatggggtcgac
ttccagctcagtcgggaggccctgaaacacgtttatctgtccgggatcaactcctggaaa
aaacgtctgattcgcatcaagaatggcatccttaggggtgtataccctggcagccctacc
agctggctggttgtcatcatggcaacagtgggttcctcctactgcaacgtggacatctct
atggggctagtctctcatatccagagatgcctccctgagggatgtggcccctaccagaca
ccgcagacccgggcacttctcagcatggccatcttctccacgggggtctggatgacgggt
atctttttcttccgccaaaccctgaaactgcttctttcctaccacggttggatgtttgag
atgcatggccagaccagccactttaccaaagtctgggctatctgtgtccgccttctgtcc
agccggcggcccatgctctacagcttccagacatctctgcccaagcttcccgtgcctagt
gtgccggccacaattcagcggtacctggaatctgtgcggcccttgctggataacgaggaa
tattaccgcatggagatgctggccaaggaattccaggacaagactgcccctcggctgcag
aagtatctggtactcaagtcgtggtgggcaactaactatgtgagtgattggtgggaagag
tacatctacctccgaggcaggacccccctcgtggtgaatagcaactattatgtcatggac
tttgtgctcatcaagaacacagatgtgcaggcagcccgcctgggaaacatcgtccatgcc
atgatcatgtatcgccgtaaactggaccgtgaagagatcaagcctgtgatggccctgggc
atggtgcctatgtgctcctaccagatggagaggatgttcaacaccacccgcatcccaggc
aagaagacagacgtgctgcagcacctctcggacagcagacatgtggccgtctaccacaag
ggccgcttcttcaaggtgtggctctatgagggctcccgcctgctcaagccccgagacctg
gagatacagttccagaggatcctggatgacccctccctgcctcagcccggggaggagagg
ctggcggccctcactgcggggggaagagtggagtgggcgcaggcacgccaggccttcttt
ggctctggcaagaacaaggcttctctggatgccatcgaacgtgctgctttcttcgtggcc
ctggatgaggagtctcaccactacgaccctgaagacgaggccagcctcagcctctatggc
aaggccctgctgcatggcaactgctacaacaggtggttcgacaagtctttcactctcatc
tccttcaagaatggccacgtgggcctcaacacagaacatgcgtgggcagacgcccctatc
atagggcatctctgggagtttgtcctaggcactgacaccttccacctgggctacacggag
gctgggcactgcataggcaaatcgaactccatgctggcacctcctcagcggctgcagtgg
gacattcctgaccagtgccaggcagtcatcgagagttcctaccaggtggccaaggcactg
gcagacgacgtggagttgtactgcttccagttcttgccctttggcaaaggcctcatcaag
aagtgccggaccagccctgacgcctttgtgcagatcgccctgcagctggctcacttccgg
gacaggggcaggttctgcctgacctatgaagcctcgatgactagaatgttccgggaggga
cggaccgagaccgtacgttcctgtactagcgagtccacagcctttgttcaggccatggtg
gaagggacccacatgaaagcacacctccaaaatctcttccggaaagcttctgaaaagcac
cagaatatgtaccgcctggccatgacgggggctgggattgacaggcacctcttctgcctc
tacgtggtctccaagtacctgggggtcagctctcctttcctggctgaggtgctctcagaa
ccctggcgcctctccaccagccagattgctcaattccagatccgcatgtttgacccagac
cagtaccccaatcacctgggccccggcggtggctttggccctgtagcagatgatggctat
ggggtttcctacatgattgcaggagagaacaccatcttcttccacgtttcaagcaagttc
tcaagctcagagacgatggctgattctgaccctggggaaagaaactatgacaacatgcta
aaaatgctgtcagacctgaataaagacttggaaaagctattggaagagatggagaaaata
tcagtgcaggccacatggatggcctacgacatggtggtgatgcgcaccaaccccacactg
gcagagtccatgcggcggctggaggacgcctttctcaactgcaaggaggagatggagaag
aactggcaagagctgctcagtgagaccacgcgcaagcagtag

DBGET integrated database retrieval system