KEGG   Equus asinus (ass): 106846122Help
Entry
106846122         CDS       T04645                                 

Gene name
CNIH1
Definition
(RefSeq) cornichon family AMPA receptor auxiliary protein 1
  KO
K20368  protein cornichon
Organism
eai  Equus asinus (ass)
Brite
Membrane trafficking [BR:eai04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    106846122 (CNIH1)
Transporters [BR:eai02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   106846122 (CNIH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cornichon
Motif
Other DBs
NCBI-GeneID: 106846122
NCBI-ProteinID: XP_014720198
LinkDB All DBs
Position
Un
AA seq 144 aa AA seqDB search
MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHA
FFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGW
CKLAFYLLAFFYYLYGMIYVLVSS
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcacgttcgcggccttctgctacatgctggcgctgctgctcaccgccgcgctc
atcttcttcgccatctggcacattatagcatttgatgagctgaagactgattacaagaat
cctatagaccagtgtaataccctgaatcctcttgtacttccagagtacctcatccatgct
ttcttctgtgtcatgtttctttgtgcagcagagtggcttacactgggtctcaatatgccc
ctcttggcatatcatatttggaggtatatgagtagaccagtgatgagtggaccgggactc
tatgaccccacaaccatcatgaatgcagatattctagcatattgtcagaaagaaggatgg
tgcaaattagctttttatcttctagcatttttttactacctatacggcatgatctatgtt
ttggtaagctcttag

DBGET integrated database retrieval system