KEGG   Equus asinus (ass): 106846783Help
Entry
106846783         CDS       T04645                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
eai  Equus asinus (ass)
Pathway
eai00590  Arachidonic acid metabolism
eai01100  Metabolic pathways
eai04064  NF-kappa B signaling pathway
eai04370  VEGF signaling pathway
eai04625  C-type lectin receptor signaling pathway
eai04657  IL-17 signaling pathway
eai04668  TNF signaling pathway
eai04723  Retrograde endocannabinoid signaling
eai04726  Serotonergic synapse
eai04913  Ovarian steroidogenesis
eai04921  Oxytocin signaling pathway
eai04923  Regulation of lipolysis in adipocytes
eai05140  Leishmaniasis
eai05163  Human cytomegalovirus infection
eai05165  Human papillomavirus infection
eai05167  Kaposi sarcoma-associated herpesvirus infection
eai05200  Pathways in cancer
eai05204  Chemical carcinogenesis
eai05206  MicroRNAs in cancer
eai05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:eai00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    106846783 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    106846783 (PTGS2)
   04064 NF-kappa B signaling pathway
    106846783 (PTGS2)
   04668 TNF signaling pathway
    106846783 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    106846783 (PTGS2)
   04657 IL-17 signaling pathway
    106846783 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocyte
    106846783 (PTGS2)
   04913 Ovarian Steroidogenesis
    106846783 (PTGS2)
   04921 Oxytocin signaling pathway
    106846783 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    106846783 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    106846783 (PTGS2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    106846783 (PTGS2)
   05206 MicroRNAs in cancer
    106846783 (PTGS2)
   05204 Chemical carcinogenesis
    106846783 (PTGS2)
   05222 Small cell lung cancer
    106846783 (PTGS2)
  09167 Infectious diseases
   05163 Human cytomegalovirus infection
    106846783 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    106846783 (PTGS2)
   05165 Human papillomavirus infection
    106846783 (PTGS2)
   05140 Leishmaniasis
    106846783 (PTGS2)
Enzymes [BR:eai01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     106846783 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 106846783
NCBI-ProteinID: XP_014721276
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCVALALGHAANPCCSNPCQNRGVCMSVGFDQYQCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGVWNIVNSFPFLRNAVMKYVLVSRSHLIESPPTYNAQY
GYKSWESFSNLSYYTRALPPVADGCPTPMGVKGKKELPDSKEIVEKFLLRRKFIPDPQGT
NMMFAFFAQHFTHQFFKTDPKRGPAFTKGLGHGVDLSHIYGETLDRQHKLRLFKDGKMKY
QIINGEVYPPTVKDTQVEMIYPPHIPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIDDQEYNFQQFLYNNSILLEHGLTQFVESFSRQIAGRV
AGGRNVPAAAQKIAKASIDQSREMKYQSLNEYRKRFRLTPYKSFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVELGAPFSLKGLLGNPICSPDYWKPSTFGGEV
GFKIINTASIQSLICNNVKGCPFTAFSVQDPQLSKAVTINASASHSGLDDVNPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcgcgccctgctgctctgcgtcgccctggcgctcggccacgcagcaaatcct
tgctgttccaacccgtgtcaaaaccgaggcgtatgtatgagtgtgggatttgaccagtat
cagtgtgactgcacgcgcacaggattctatggtgaaaactgttcaacacctgaatttctg
acaaggataaaattattcctgaaacctactccaaacacagtacactacatacttacccac
ttcaagggagtctggaacattgtcaatagctttcccttcctgcgaaatgcagttatgaaa
tacgtgttagtatccagatcacatttgattgagagcccgccaacttacaatgcacagtat
ggctataagagctgggaatccttttccaacctctcatattacaccagagctcttcctcct
gtggctgacggctgcccaacccccatgggtgtgaaagggaagaaagagcttcctgattca
aaagagattgtggaaaaatttctcctaagaagaaagttcatccctgacccccagggcaca
aatatgatgtttgcattttttgcccagcacttcacccatcagtttttcaagacagatcct
aagcgaggtccagctttcaccaaaggcctgggtcacggggtggatttaagtcatatttat
ggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaatat
cagatcattaatggcgaggtgtatccgcccacagtcaaagacactcaggtggagatgatc
tacccgcctcatattcctgagcacctgcggtttgctgtggggcaggaggtctttggtctg
gtgcctggcctgatgatgtatgccacgatttggctgcgggaacacaacagagtgtgtgat
gtcctcaaacaggagcatccagaatgggatgatgaacgcttgttccagacgagcaggctc
atactgataggagaaactatcaagatcgtgattgaagactacgtacagcacctgagcggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccaataccaa
aaccgcattgccgctgagttcaacacactctatcactggcatccccttctgcctgacacc
tttcaaatcgatgaccaggagtacaactttcaacagtttctctacaacaactctatctta
ctggaacatggactcacccagtttgttgaatctttcagcaggcaaattgctggcagggtg
gctggtggtaggaatgttccagctgcagcacagaaaatagcaaaggcctcaatcgaccag
agcagagagatgaagtaccagtctctgaatgagtaccgcaaacgctttcggctgacgccc
tataaatcatttgaagaacttacaggagagaaggaaatggctgcggagttagaagcactc
tatggtgacattgatgccatggagctgtatcctgcccttctggtggaaaagcctcgccca
gatgccatcttcggggagaccatggtagaacttggggcaccattctccttgaaaggactt
ttgggtaatcctatctgttctcctgactactggaaacccagcacttttggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcaataacgtgaagggc
tgtccttttactgccttcagtgttcaggacccgcagctcagcaaagcagtcaccattaat
gccagcgcttcccactctggactagatgacgtgaatcccacagtactgctcaaagaacgc
tcaactgaactgtag

DBGET integrated database retrieval system