KEGG   Equus asinus (ass): 106847042Help
Entry
106847042         CDS       T04645                                 

Gene name
HDAC2
Definition
(RefSeq) histone deacetylase 2
  KO
K06067  histone deacetylase 1/2 [EC:3.5.1.98]
Organism
eai  Equus asinus (ass)
Pathway
eai04110  Cell cycle
eai04213  Longevity regulating pathway - multiple species
eai04330  Notch signaling pathway
eai04919  Thyroid hormone signaling pathway
eai05016  Huntington disease
eai05034  Alcoholism
eai05165  Human papillomavirus infection
eai05169  Epstein-Barr virus infection
eai05200  Pathways in cancer
eai05202  Transcriptional misregulation in cancer
eai05203  Viral carcinogenesis
eai05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:eai00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    106847042 (HDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    106847042 (HDAC2)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    106847042 (HDAC2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    106847042 (HDAC2)
 09160 Human Diseases
  09161 Cancers
   05200 Pathways in cancer
    106847042 (HDAC2)
   05202 Transcriptional misregulation in cancers
    106847042 (HDAC2)
   05203 Viral carcinogenesis
    106847042 (HDAC2)
   05220 Chronic myeloid leukemia
    106847042 (HDAC2)
  09163 Neurodegenerative diseases
   05016 Huntington disease
    106847042 (HDAC2)
  09164 Substance dependence
   05034 Alcoholism
    106847042 (HDAC2)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    106847042 (HDAC2)
   05165 Human papillomavirus infection
    106847042 (HDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:eai03036]
    106847042 (HDAC2)
Enzymes [BR:eai01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106847042 (HDAC2)
Chromosome and associated proteins [BR:eai03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     106847042 (HDAC2)
   HDAC complexes
    Sin3A-HDAC complex
     106847042 (HDAC2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    106847042 (HDAC2)
  Chromatin remodeling factors
   NuRD complex
    106847042 (HDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 106847042
NCBI-ProteinID: XP_014721642
LinkDB All DBs
Position
Un
AA seq 488 aa AA seqDB search
MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKA
TAEEMTKYHSDEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVA
GAVKLNRQQTDMAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHH
GDGVEEAFYTTDRVMTVSFHKYGEYFPGTGDLRDIGAGKGKYYAVNFPMRDGIDDESYGQ
IFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVKGHAKCVEVVKTFNLPLLMLG
GGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTPEYM
EKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKDTEDKKTDVKEEDKSKDNSGEKTDTKGA
KSEQLSNP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacagtcagggaggtggcaagaagaaagtctgctactactacgatggtgatatt
ggaaattattattatggacagggtcatcccatgaaacctcatagaatccgcatgacccat
aacttgctgctaaattatggcttatatagaaaaatggaaatatacaggccccataaagcc
actgctgaagaaatgacaaaataccacagtgatgagtacatcaaatttctccgttcaata
agaccagataacatgtctgagtatagtaagcagatgcagagatttaatgttggagaggat
tgtccagtgtttgatggactctttgagttttgtcagctctccactggtggctcagttgct
ggggctgtgaagttaaaccgacaacaaactgatatggctgttaattgggctggaggatta
catcacgctaagaaatcagaagcgtcggggttctgttatgttaatgatattgtgcttgcc
atccttgagttactaaagtatcatcagagagtcttatatattgatattgatattcatcat
ggtgatggtgttgaagaagctttttatacaacagatcgtgttatgactgtatcattccat
aaatatggggaatactttcctggaacaggagacttgagggatattggtgcaggaaaaggc
aaatactatgctgtgaattttccaatgagagatggcatagatgatgagtcatatgggcag
atatttaagcctattatctcgaaagtgatggagatgtaccagcccagcgcggtggtgctg
cagtgcggcgccgactcgctgtccggggacaggctgggctgcttcaatctcacggtcaaa
ggtcatgctaaatgtgtagaagttgtaaaaactttcaatttaccgttgctgatgcttggg
ggaggcggatacacaatccgtaatgttgctcgatgttggacgtatgagactgcagttgcc
cttgattgtgagattcccaatgaattgccatataatgattactttgagtattttggaccg
gacttcaaactgcatattagtccttcaaacatgacaaaccagaacactccagaatatatg
gaaaagataaaacagcgtttatttgaaaatttacgcatgttaccacatgcacctggtgtc
caaatgcaagctattccagaagatgctgttcatgaagacagtggagatgaagacggagaa
gatccagacaagagaatttctattcgggcatcagacaagcggatagcttgtgatgaagaa
ttctcagattctgaggacgaaggagaaggaggtcgtagaaatgtggctgatcataagaaa
ggagcaaagaaagctagaattgaggaagacaagaaagacacagaggacaaaaaaacagat
gttaaggaagaagataaatccaaggacaatagtggtgaaaaaacagataccaaaggagcc
aaatcagaacagctcagcaacccttga

DBGET integrated database retrieval system