KEGG   Ensifer alkalisoli: EKH55_2172
Entry
EKH55_2172        CDS       T06241                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eak  Ensifer alkalisoli
Pathway
eak00473  D-Alanine metabolism
eak00550  Peptidoglycan biosynthesis
eak01100  Metabolic pathways
eak01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EKH55_2172
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EKH55_2172
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EKH55_2172
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eak01011]
    EKH55_2172
Enzymes [BR:eak01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EKH55_2172
Peptidoglycan biosynthesis and degradation proteins [BR:eak01011]
 Precursor biosynthesis
  Amino acid ligase
   EKH55_2172
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATPgrasp_ST CPSase_L_D2 ATP-grasp_3 GARS_A
Other DBs
NCBI-ProteinID: QFI67046
UniProt: A0A5P6NM50
LinkDB
Position
1:complement(2154456..2155328)
AA seq 290 aa
MSLSSGAACADALEAEGYRVTRVDVGRDVAAVLAELRPDVVFNALHGPFGEDGTIQGILE
YLEIPYTHSGVLASALAMDKAQAKHVAKAAGIPVAEALVMDRHAFDSKHPMKPPYVVKPV
CEGSSFGVVIVKEDQSHPPQVITSSEWRYGDRVMVERYVAGRELTCGVMGDMALGVTEII
PQGHAFYDYDSKYVKGGSRHVIPAEISPNIYQKIQTLALKAHEAIGCRGVSRSDFRFDDR
GEGEGEVIWLEINTQPGMTPTSLVPEMAQHAGLRFGEFLRWMVEDASCLR
NT seq 873 nt   +upstreamnt  +downstreamnt
gtgagcctgtcctccggggcagcttgcgcggatgctctggaagccgagggttatcgcgtc
acgcgcgtggatgtcgggcgcgatgttgcggcggtactggcggaactgcgtcctgatgtc
gtcttcaacgcgctccacggccccttcggcgaggacgggacgatccagggcatcctggaa
tatctggaaattccctatacgcattccggcgtgcttgcctccgcgctcgccatggacaag
gcgcaggcaaaacatgtcgccaaggctgccggcataccggtcgccgaagccttggtgatg
gatcgccatgctttcgacagcaaacatccgatgaagccgccctatgtggtcaagccggtg
tgcgaaggctcgagcttcggcgtcgtcatcgtcaaggaggatcagtcgcatccgccgcag
gtcatcacgtcgagcgagtggcgctacggcgaccgggtcatggtcgagcgctatgtcgcc
gggcgcgaactcacctgcggcgtgatgggtgacatggctctcggcgtcaccgaaatcatt
ccccagggccatgccttctacgactatgattccaaatacgtaaaaggtggttcaagacac
gtcattcccgctgagatttcaccaaatatttaccaaaaaatacaaacactcgcattgaag
gcgcatgaggctatcggctgccgcggcgtcagtcgttccgacttccgtttcgatgatcgc
ggcgagggcgagggcgaggttatctggctggagatcaacacccagcccggcatgaccccg
acctctcttgttcctgaaatggcacagcatgcgggccttcggtttggtgaatttctcagg
tggatggtggaggacgcatcgtgcttgcgttga

DBGET integrated database retrieval system