KEGG   Escherichia albertii: EAKF1_ch0729cHelp
Entry
EAKF1_ch0729c     CDS       T03986                                 

Gene name
tolA
Definition
(GenBank) cell envelope integrity inner membrane protein TolA
  KO
K03646  colicin import membrane protein
Organism
eal  Escherichia albertii
Brite
KEGG Orthology (KO) [BR:eal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eal02000]
    EAKF1_ch0729c (tolA)
Transporters [BR:eal02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   EAKF1_ch0729c (tolA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TolA TonB_C THRAP3_BCLAF1
Motif
Other DBs
NCBI-ProteinID: AHE58638
UniProt: W0AMQ6
LinkDB All DBs
Position
complement(760222..761382)
Genome map
AA seq 386 aa AA seqDB search
MSKATEQNDKLKRAIIISAVLHIILFAALIWSSFDENMEASAGGGGGSSIDAVMVDSGAV
VEQYKRMQNQESSAKRSEEQLKIKERQAAEELREKQAAEQERLKQLEKERLAAQEQKKQA
EEAAKQAELKQKQAEEAAAKAAADAKAKAEADAKAAAEAAKKAAADAKKKAEAEAAKAAA
EAQKKAEAEAAKAAAALKKKAEAAEAAAAEARKKAAAEAAEKKAAAEKAAAEKKAAAEKA
AAEKKAAAEKAAAAKAAAEADDLFGELSSGKNAPKTGGGAKGSNVSSTGSGNTKSSASGA
EINDYKNQIATAIASRLNDKSLYVGKTCRLHIKLTTDGTVLSVESEGGDEALCRAALVAV
NQAKLPKPPSQAVYEVFKDASLNFKP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaggcaaccgaacaaaacgacaagctcaaacgggcgataattatttcagcagtg
ctgcatatcatcttatttgcggcactgatctggagttcgttcgatgagaatatggaagct
tcagccggtggcggcggtggttcatccatcgacgcggtaatggttgattcaggtgcagtc
gttgagcagtacaaacgcatgcaaaaccaggaatcaagcgcgaagcgttctgaagagcag
ctcaagattaaggagcggcaggccgctgaagaactgcgtgaaaaacaagctgcggaacag
gaacgcctgaagcaacttgagaaagagcggttagccgctcaggagcaaaagaaacaggct
gaagaagctgccaaacaggccgagttgaagcagaagcaagcggaagaagcagcagcgaaa
gctgcggcagatgctaaagcgaaggccgaagcggatgccaaagcagccgcagaagctgcg
aagaaagcggctgcggacgcgaagaaaaaagcagaagcagaagccgccaaagctgcagct
gaagcgcagaaaaaagccgaggctgaagccgctaaagctgctgctgcgctgaagaagaaa
gcagaagcggcggaagccgcagcagctgaggcaagaaagaaagcggctgccgaggctgct
gagaagaaagctgcagcagaaaaggccgcagctgagaagaaagcggcggcagaaaaggcc
gccgcagagaaaaaagcagctgctgaaaaagccgctgcagcaaaagctgccgcggaggcg
gatgatcttttcggtgagctaagctccggtaagaatgcaccgaaaaccggtggtggggcg
aaaggcagcaatgtttcctctaccgggagtggtaatactaaaagtagcgcatcaggcgct
gagattaatgactacaagaaccagattgctacggctatagccagcaggctcaacgacaag
tcattgtatgtcgggaaaacgtgcagattgcatatcaaactgactacagatggcactgta
cttagcgttgagtcagaaggtggtgatgaagcattatgccgggccgcgcttgttgctgtt
aatcaagcaaaattgcctaagccaccgagccaggctgtatatgaggtattcaaagatgct
tctctgaactttaagccgtaa

DBGET integrated database retrieval system