KEGG   Escherichia albertii: EAKF1_ch0854cHelp
Entry
EAKF1_ch0854c     CDS       T03986                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
eal  Escherichia albertii
Brite
KEGG Orthology (KO) [BR:eal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EAKF1_ch0854c (ahpF)
Enzymes [BR:eal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     EAKF1_ch0854c (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Glutaredoxin DAO FMO-like NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: AHE58760
UniProt: W0AR42
LinkDB All DBs
Position
complement(895326..896921)
Genome map
AA seq 531 aa AA seqDB search
MMMFKAQEINMLDTNMKTQLKAYLEKLTRPVELIATLDDSAKSAEIKELLAEIAELSDKV
TFKEDNSLPVRKPSFLITNPGSNQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLE
QIRDIDGDFEFETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGTFQNEITDRNVMG
VPAVFVNGKEFGQGRMTLTEIVAKIDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIY
SARKGIRTGLMGERFGGQILDTVDIENYISVPKTEGQKLAGALKVHVDEYDVDVIDSQSA
SKLIPAAVEGGLHQIETASGAVLKARSIIVATGAKWRNMNVPGEEQYRTKGVTYCPHCDG
PLFKGKRVAVIGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKLRSLKNVDIIL
NAQTTEVKGDGSKVVGLEYRDRVSGDIHNIELAGIFVQIGLLPNTNWLEGAVERNRMGEI
IIDAKCETNVKGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKTA
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgtttaaagcccaggagataaacatgctcgacacaaatatgaaaactcaactc
aaggcgtaccttgagaaattgaccaggcctgttgagttgattgccacgctggatgacagc
gcaaaatcggcagaaatcaaggaactgttggctgaaatcgctgaactgtcagacaaagtc
acctttaaagaagataacagcttgccggtgcgtaagccgtctttcctgatcactaaccca
ggttctaaccaggggccgcgttttgcaggttccccgctgggtcacgagttcacctcgctg
gtactggcgctgctgtggaccggtggtcatccgtcgaaagaagcgcagtctctgctggag
cagattcgcgatattgatggtgattttgaattcgaaacttattactcgctctcctgccac
aactgcccggacgtagtacaagcgctgaacctgatgagcgtattgaatccgcgcattaag
cacacggcgattgatggtggtacgttccagaacgaaatcaccgatcgtaacgtgatgggc
gttccggctgtgttcgtgaatggtaaagagtttggtcagggccgtatgacgctgactgaa
atcgtggcgaagattgatactggcgcagaaaaacgtgcggcagaagagctgaacaaacgc
gacgcttacgatgtgttgatcgtcggctccggcccggcgggcgcagcagcagcgatttac
tccgcgcgtaaaggcattcgcacgggtctgatgggcgaacgtttcggcggtcagatcctc
gatactgtggatatcgaaaactatatctctgtgccgaaaaccgaaggccagaaactggct
ggcgccctgaaagtccacgttgatgaatacgatgtggatgtcattgacagccagagcgcc
agcaaactgattccggcggctgttgaaggcggtctgcatcagattgaaactgcgtccggc
gcagtgctgaaagcacgcagcattatcgtggcgaccggcgcgaaatggcgtaacatgaac
gttccgggtgaagaacagtatcgcactaaaggtgtaacttactgcccgcactgtgacggt
ccgctgtttaaaggtaaacgtgtggcggtgattggtggcggtaactctggcgtggaagcg
gcaattgacctggctggtattgttgaacacgtaaccctgcttgagtttgcgccagaaatg
aaagccgaccaggtattgcaggacaaactgcgtagtctgaaaaacgtcgacatcattctg
aatgcgcaaaccaccgaagtgaaaggcgacggtagcaaggtcgttggtctggaataccgt
gatcgcgtaagcggcgatattcacaacatcgaactggccggtattttcgtccagattggt
ctgctgccgaacaccaactggctggaaggcgcagtcgaacgtaaccgcatgggtgagata
atcatcgatgcgaaatgcgaaactaacgtcaaaggcgtattcgctgctggtgactgtaca
actgttccgtacaagcagatcatcatcgccactggcgaaggtgctaaagcctctctgagt
gcttttgattacctgattcgcactaaaacagcataa

DBGET integrated database retrieval system