KEGG   Escherichia albertii: EAKF1_ch1056Help
Entry
EAKF1_ch1056      CDS       T03986                                 

Gene name
ddl
Definition
(GenBank) D-alanyl-alanine synthetase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eal  Escherichia albertii
Pathway
eal01100  Metabolic pathways
eal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EAKF1_ch1056 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAKF1_ch1056 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    EAKF1_ch1056 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:eal01011]
    EAKF1_ch1056 (ddl)
Enzymes [BR:eal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EAKF1_ch1056 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:eal01011]
 Precursor biosynthesis
  Amino acid ligase
   EAKF1_ch1056 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST CPSase_L_D2 ATP-grasp_3 ATP-grasp_4 RimK GARS_A
Motif
Other DBs
NCBI-ProteinID: AHE58959
UniProt: W0ARL9
LinkDB All DBs
Position
1114533..1115627
Genome map
AA seq 364 aa AA seqDB search
MEKLRIGIVFGGKSAEHEVSLQSAKNIVDAIDKSRFDVVLLGIDKQGQWHVSDANNYLLN
ADDPAHIALRPSATSLAQVPGKHEHQLIDAQNGQPLPTVDVIFPIVHGTLGEDGSLQGML
RVANLPFVGSDVLASAACMDKDVTKRLLRDAGLNIAPFITLTRANRHKISFAEVQSKLGL
PLFVKPANQGSSVGVSKVTSEEQYAIAVDLAFEFDHKVIVEQGIKGREIECAVLGNDDPQ
ASTCGELVLTSDFYAYDTKYIDEDGAKVVVPANIAPEINDKIRAIAVQAYQTLGCAGMAR
VDVFLTPENDVVINEINTLPGFTNISMYPKLWQASGLSYTDLITRLIELALERHAADNAL
KTTM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaactgcggataggtatcgtttttggtggaaaatcagcagaacatgaagtgtct
ttgcaatcggcaaaaaatattgtcgatgccattgataaaagccgtttcgacgttgtgctg
ctgggcattgataaacaagggcaatggcacgtcagcgatgccaacaattatctgctgaat
gcagacgatcctgcccatattgcgctacgcccttctgcgaccagcctcgcacaggtgcca
ggcaagcatgagcatcagcttatcgatgcgcaaaacggtcagccgttgccaacggtggat
gtcattttcccgattgtccacggtacgctgggtgaagatggttccttgcagggaatgcta
cgggtcgccaatttaccgtttgtcggttcagatgttctggcttctgccgcttgcatggat
aaagacgtcaccaaacgtctactgcgcgacgccgggttgaacatcgcgccatttattact
ctgacgcgtgctaatcgccacaaaatcagttttgccgaagtgcagtctaaactgggttta
ccgctgtttgtaaaaccggccaaccagggttcctcggttggcgtcagcaaagtaaccagt
gaagaacaatacgcaattgccgtcgatctagcattcgagttcgatcataaagtgatcgtt
gagcaagggatcaaaggccgtgagatcgaatgcgccgttctgggtaatgacgatccgcaa
gccagcacctgcggtgagctcgtgctgaccagtgatttctacgcctacgacaccaagtac
attgatgaagatggcgcgaaagtggtggttcctgcgaacattgcaccggaaattaacgac
aaaatccgggcgatcgcagtgcaggcttatcagacgctggggtgtgccggtatggcacga
gtggacgtctttttaaccccggaaaatgacgtggtgatcaatgagatcaacacactacct
ggattcactaacatcagtatgtatccgaaactgtggcaagcgagcggtctgagttacacc
gacctcatcacgcgtttgattgaactggcgctggagcgccacgctgcggataacgcattg
aaaaccacgatgtga

DBGET integrated database retrieval system