KEGG   Escherichia albertii: EAKF1_ch1698cHelp
Entry
EAKF1_ch1698c     CDS       T03986                                 

Definition
(GenBank) protein EspF
  KO
K12786  LEE-encoded effector EspF
Organism
eal  Escherichia albertii
Pathway
eal05130  Pathogenic Escherichia coli infection
Module
eal_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:eal00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    EAKF1_ch1698c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF
Motif
Other DBs
NCBI-ProteinID: AHE59582
UniProt: W0ATS5
LinkDB All DBs
Position
complement(1797205..1797618)
Genome map
AA seq 137 aa AA seqDB search
MTPTRPAPQPPISGRASAPSQHLPPIAQALKDHLAAYEQSKASGTSTLKPARQAPPPPTS
GQTSGPAKPLPPLAQALKEHLAAYEKSKASDTSPLKPARPAPPPPTSGRASGSSQSLPPL
AQALKDHLAAYEQSKKG
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgacccccactcgtccagcaccacagccaccgataagtggtcgggcatctgctccatcc
caacatttaccaccaattgctcaggcattaaaagatcatttagctgcctatgagcaatcg
aaagcttctggcacttcaacccttaaaccagcccgccaggcgccaccgccaccgacaagt
gggcagacatccgggccagccaagcctttaccaccattagcgcaggcattaaaagagcat
ttagctgcctatgaaaaatcgaaagcttctgatacgtcaccccttaaaccagcccgcccg
gcaccaccgccaccgacaagtggtcgggcatctggttcatcccagtctttacccccactt
gctcaggcattaaaagatcatttagccgcctatgaacaatcgaaaaaaggataa

DBGET integrated database retrieval system