KEGG   Escherichia albertii: EAKF1_ch1957Help
Entry
EAKF1_ch1957      CDS       T03986                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eal  Escherichia albertii
Pathway
eal00620  Pyruvate metabolism
eal00680  Methane metabolism
eal01100  Metabolic pathways
eal01120  Microbial metabolism in diverse environments
eal01200  Carbon metabolism
Module
eal_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAKF1_ch1957 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    EAKF1_ch1957 (ppc)
Enzymes [BR:eal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EAKF1_ch1957 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AHE59835
UniProt: W0AU75
LinkDB All DBs
Position
2068733..2071384
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGEHILERVETIRKLSKSSRAGNDANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPDLDAA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNTCLKQLDNKDIADYERNQLMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYKLPVEF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVDATPELL
ALVGEEGAAEPYRYLMKNLRSRLMATQAWLEARLKGEELPKPEGLLTQNEELWEPLYACY
QSLQACGMGIIANGDLLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRNWQPSAETREVLDTCQVIAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNANDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEITVSSLSLYTGAILEANLLPPPEPKESWRRIMDEL
SVISCDVYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQNELETMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVAKELWSLGKELRNLQEEDIKVVLAIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRQAEKEGHEPDPRVEQALMVTIAGIAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcattgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgttgggcgaacacattcttgaacgcgtagaaactatccgtaag
ttgtccaaatcttcacgcgctggcaatgatgctaaccgccaggagttactcaccacctta
caaaatttgtcgaacgacgagctgctgcccgttgcacgtgcgtttagtcagtttctgaat
ctggccaacaccgctgagcaatatcatagcatttcgccgaaaggcgaggctgccagcaac
ccggaagtcattgcccgcaccctgcgtaaactgaaaaaccagccagaccttgacgctgct
acgatcaaaaaagcggtggaatcgctgtcgctggaactggttctgaccgcgcacccgacc
gaaattacccgtcgtacgctgatccacaaaatggtggaagtgaacacttgtttgaaacag
ctcgataacaaagacatcgctgactacgagcgaaaccaactgatgcgccgcctgcgtcag
ttgatcgctcagtcctggcataccgatgaaatccgtaaacagcgcccaagcccggtagat
gaagccaaatggggctttgccgtggtggaaaacagcctgtggcaaggcgtgccgaattat
ctgcgcgaactgaacgaacaactggaagagaatctcggctacaaactgccagtggaattt
gttccggtccgttttacttcgtggatgggcggcgaccgtgacggtaacccgaacgttacc
gcggatatcacccgacacgttttgttgctcagccgctggaaagcgaccgatctgttcctg
aaagatattcaggttctggtttctgaactgtcgatggttgacgcgacgcctgaactgctg
gcactggtcggcgaagaaggcgccgcagaaccgtatcgctatctgatgaaaaacctgcgc
tcccgtctgatggcgacacaggcctggctggaagcacgtctgaaaggcgaagaactgccg
aagccagaaggtctgctgacgcaaaacgaagaactttgggagccgctctacgcttgttat
cagtcacttcaggcatgtggcatgggaattatcgccaacggcgatctgctcgataccctg
cgtcgtgtgaaatgtttcggcgtaccgctggtacgtattgatatccgccaggagagcacc
cgtcataccgaagcattgggcgagctgacccgctacctcggcattggcgattacgaaagc
tggtcagaagccgacaaacaagcattcctgatccgtgaactgaactctaaacgtccattg
ctgccgcgcaactggcagccaagcgccgaaacacgtgaagtgcttgatacctgtcaggtc
attgccgaagcgccacaaggttcgattgccgcctatgtgatctcaatggcgaaaacgccg
tccgacgtactggccgtccacctgttactgaaagaagcaggtattggatttgcgatgcca
gtcgcaccgctttttgaaaccctggatgacctgaacaacgctaacgatgtcatgacccag
ttgctgaatatcgactggtatcgcggcctgattcagggcaaacagatggtgatgattggc
tattccgactcagcaaaagatgcgggcgtgatggcggcatcctgggcgcaatatcaggca
caagatgcgttaatcaaaacctgcgaaaaagcgggcattgaactgacgctgttccacggc
cgcggcggttccattggtcgcggcggcgcaccggcccatgcggcactgctgtcgcaaccg
ccgggaagcctgaaaggcggcctgcgtgtgaccgaacagggcgagatgatccgcttcaag
tacggtctgccagaaatcactgttagcagcctttcgctgtataccggggcgattctggaa
gccaacctgctgccgccaccggagccgaaagagagctggcgtcgcattatggatgaactg
tctgtcatctcttgcgatgtctaccgcggctacgtgcgtgaaaacaaagattttgtacct
tacttccgctctgccacgccagagcaggaactcggcaaactgccgttgggatcacgtccg
gcgaaacgtcgcccgaccggcggtgtcgaatcattgcgcgccattccgtggatttttgcc
tggacgcaaaaccgcctgatgctgccagcctggctgggcgcaggtacggcgctgcaaaaa
gtggtggaagatggcaaacagaacgagctggaaaccatgtgtcgcgactggcctttcttc
tcaacgcgccttggaatgctggagatggttttcgccaaagcggatctgtggctggcggaa
tactacgatcagcggctggtcgcaaaagagctttggtcgctgggtaaagagttacgcaat
ctacaagaagaagacatcaaagtcgtgctggcgattgccaatgactcccatctgatggcg
gatctaccgtggattgccgagtctattcagctacgaaatatttacaccgacccgctaaac
gtactgcaagcagaattgttgcaccgttcccgtcaggcggaaaaagaaggccacgaacca
gatcctcgcgttgaacaagcgttaatggtcactattgccgggatcgcggcaggtatgcgt
aataccggttaa

DBGET integrated database retrieval system