KEGG   Escherichia albertii: EAKF1_ch2433Help
Entry
EAKF1_ch2433      CDS       T03986                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase GadB
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
eal  Escherichia albertii
Pathway
eal00250  Alanine, aspartate and glutamate metabolism
eal00410  beta-Alanine metabolism
eal00430  Taurine and hypotaurine metabolism
eal00650  Butanoate metabolism
eal01100  Metabolic pathways
eal01110  Biosynthesis of secondary metabolites
eal01120  Microbial metabolism in diverse environments
eal02024  Quorum sensing
Module
eal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    EAKF1_ch2433 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAKF1_ch2433 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAKF1_ch2433 (gadB)
   00430 Taurine and hypotaurine metabolism
    EAKF1_ch2433 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    EAKF1_ch2433 (gadB)
Enzymes [BR:eal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     EAKF1_ch2433 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC PRTase_3
Motif
Other DBs
NCBI-ProteinID: AHE60304
UniProt: W0AVC8
LinkDB All DBs
Position
2589029..2590429
Genome map
AA seq 466 aa AA seqDB search
MEQKLLTDFRSELLDSRFGTKAISTIAESKRFPLHEMREDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPKELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVATYLADEIAKL
GPYEFICTGRPDEGIPAVCFRLKDGEDPGYTLYDLSERLRLRGWQVPAFALSGEASDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggaacagaagttgttaacggatttccgctcagaactactcgattcacgctttggcaca
aaggctatttccactatcgcggagtctaaacgttttccgctgcatgaaatgcgagaagat
gtcgcattccaaattatcaatgatgaattatatctggatggtaatgcccgacagaacctt
gctacattttgtcagacctgggacgacgaaaatgtgcataaattgatggatctgtcgatt
aataagaactggatcgataaagaagaatatccacaatctgccgccattgatctgcgttgt
gtaaacatggttgccgacctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaagcctgtatgctcggcggcatggcgatgaaatggcgt
tggcgcaaacgtatggaagctgcgggtaaaccaacggataaacccaacctggtgtgcggc
ccggtacaaatctgctggcataaattcgcccgctactgggatgtggaactgcgcgagatc
cctatgcgtcccggtcagttatttatggatccgaaacgcatgattgaagcctgcgacgaa
aacaccatcggcgtggtgccgaccttcggcgtgacttacaccggtaattatgaattcccg
caaccgctgcatgatgcgctggataaattccaggccgataccggtattgatatcgacatg
catatcgacgccgccagcggaggcttccttgcgccgtttgtcgccccggatatcgtctgg
gacttccgtctgccgcgtgtgaaatccatcagcgcttcgggccataaattcggccttgcc
ccactgggctgcggctgggttatctggcgtgacgaagaggcgctgccgaaagaactggtg
ttcaacgttgactatctcggcggtcagatagggactttcgccatcaatttctcccgcccg
gcgggtcaggtgattgcccagtactatgaatttctgcgcctcggccgtgaaggttacacc
aaagtgcagaatgcctcttatcaggttgccacctacctggcggatgaaatagccaaactg
gggccgtatgagttcatctgcaccggtcgcccggatgaaggtattccggcggtctgcttc
aggctgaaagacggagaagatccggggtataccctgtatgacctttctgaacgtctgcgc
ctgcgcggctggcaggttccggccttcgccctcagcggtgaagcctctgacatcgtggtg
atgcgcattatgtgccgtcgtggtttcgaaatggactttgctgagctgttgctggaagac
tacaaggcttctctgaaatacctcagcgatcacccgaaactgcagggtattgcgcaacag
aacagctttaaacatacctga

DBGET integrated database retrieval system