KEGG   Escherichia albertii: EAKF1_ch2538cHelp
Entry
EAKF1_ch2538c     CDS       T03986                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
eal  Escherichia albertii
Pathway
eal00564  Glycerophospholipid metabolism
eal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAKF1_ch2538c (glpD)
Enzymes [BR:eal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     EAKF1_ch2538c (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 FAD_binding_2 3HCDH_N NAD_binding_8 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: AHE60407
UniProt: W0AW61
LinkDB All DBs
Position
complement(2695665..2697185)
Genome map
AA seq 506 aa AA seqDB search
MNEGSMETKDLIVIGGGINGAGIAADAAGRGLSVLMLEAEDLACATSSASSKLIHGGLRY
LEHYEFRLVSEALAEREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRT
SLPGSTGLRFGANSVLKPEIIRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSA
RRENGLWIVEAEDIDTGKKYTWQARGLVNATGPWVKQFFDDGMHLPSPYGIRLIKGSHIV
VPRVHTQKQAYILQNEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLNV
YNAHFKKQLSRDDIVWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKL
TTYRKLAEHALEKLTPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLAR
HYARTYGSNTELLLGNAGAISDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGM
WLNAEQQSRVSQWLMEYTQQRLSLAS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgagggcagcatggaaaccaaagatctgattgtgataggtggcggcatcaatggt
gctggtatcgcggcagacgccgctggacgcggtttatccgtgctgatgctggaggcagag
gatctcgcttgtgcgacctcttctgccagttccaaacttattcacggcggcctgcgctac
cttgaacactatgaattccgtcttgtcagcgaggcgctggcagaacgtgaagtgctgttg
aaaatggccccacatatcgccttcccaatgcgttttcgtctgccgcatcgcccgcatcta
cgcccggcatggatgattcgtatcggtctttttatgtacgatcatttgggtaaacgtacc
agtttaccgggttcaacaggtttgcgttttggcgcaaattcggtgttaaaaccagaaatc
atacgcggattcgaatattctgactgttgggtagatgatgcccgtctggtattagccaat
gcccagatggtggtgcgcaaagggggtgaggtgctaacccgtacccgcgcgacttccgct
cgccgcgaaaacggtctgtggattgtggaagcagaagatatcgatactggcaaaaaatac
acatggcaggcacgcggcctggttaacgccacgggaccgtgggtgaaacagttcttcgac
gacgggatgcatttgccttcgccttatggcatccgcctgatcaaaggcagccatattgtg
gtgccgcgcgtgcatacccaaaagcaggcctacattctgcaaaatgaagataaacgtatt
gtctttgtgatcccgtggatggacgagttttccatcatcggcaccaccgatgtggagtac
aaaggcgatccgaaagcggtgaagattgaagagagtgaaatcaattacctgctgaatgtg
tataacgcgcactttaaaaagcagttaagccgtgacgatattgtctggacctattccggc
gtgcgtccactgtgtgatgatgaatccgattcgccgcaggccattacccgtgattacacg
ctcgatattcatgatgaaaacggcaaagcgccgctgctgtcggtattcggcggcaagctg
accacctaccgcaaactggcggaacatgcgctggagaaactcacgccgtattatcagggc
attggcccggcgtggacgaaagagagcgtgctaccgggtggcgctatcgaaggcgatcgt
gacgattacgccgcccgcctgcgccgccgttacccattcctgaccgaatcgctggcacgt
cattacgcacggacctatggtagcaacactgagctattactcggcaacgcaggggcgata
agtgacctcggtgaagattttggtcatgagttctacgaagcggagctgaaatatctggtc
gaccacgaatgggtccgccgcaccgacgatgccctgtggcgccgtacaaaacaaggtatg
tggctgaatgcggaacaacaatctcgtgtgagccagtggttgatggagtatacgcagcag
aggttatcgctggcgtcgtaa

DBGET integrated database retrieval system