KEGG   Escherichia albertii: EAKF1_ch3335cHelp
Entry
EAKF1_ch3335c     CDS       T03986                                 

Gene name
gabT2
Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
eal  Escherichia albertii
Pathway
eal00250  Alanine, aspartate and glutamate metabolism
eal00280  Valine, leucine and isoleucine degradation
eal00310  Lysine degradation
eal00410  beta-Alanine metabolism
eal00640  Propanoate metabolism
eal00650  Butanoate metabolism
eal01100  Metabolic pathways
eal01120  Microbial metabolism in diverse environments
Module
eal_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    EAKF1_ch3335c (gabT2)
   00650 Butanoate metabolism
    EAKF1_ch3335c (gabT2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAKF1_ch3335c (gabT2)
   00280 Valine, leucine and isoleucine degradation
    EAKF1_ch3335c (gabT2)
   00310 Lysine degradation
    EAKF1_ch3335c (gabT2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAKF1_ch3335c (gabT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eal01007]
    EAKF1_ch3335c (gabT2)
Enzymes [BR:eal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     EAKF1_ch3335c (gabT2)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     EAKF1_ch3335c (gabT2)
    2.6.1.48  5-aminovalerate transaminase
     EAKF1_ch3335c (gabT2)
Amino acid related enzymes [BR:eal01007]
 Aminotransferase (transaminase)
  Class III
   EAKF1_ch3335c (gabT2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AHE61185
UniProt: W0AY17
LinkDB All DBs
Position
complement(3497240..3498520)
Genome map
AA seq 426 aa AA seqDB search
MSSNKELMQRRSQAIPRGVGQIHPIFADRAENCRVWDVEGREYIDFAGGIAVLNTGHLHP
KVVAAVEAQLKKLSHTCFQVLAYEPYLELCEMMNQKIPGDFAKKTLLVTTGSEAVENAVK
IARAATKRSGTIAFSGAYHGRTHYTLALTGKVNPYSAGMGLMPGHVYRALYPCPLHGISE
DDAIASIHRIFKNDAAPEDIAAIVIEPVQGEGGFYAATPAFMQRLRELCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAPDLTTFAKSIAGGFPLAGVTGRAEVMDAVAPGGLGGTYAG
NPIACVAALEVLKVFEQENLLQKANDLGQKLKDGLLAIAEKHPEIGDVRGLGAMIAIELF
EGGDHSKPDAKLTAEIVARARDKGLILLSCGPYYNVLCILVPLTIEDAQIRQGLEIISQC
FAEAKQ
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaataaagagttaatgcagcgccgcagtcaggcaattcctcgtggcgttggg
caaattcacccgattttcgctgaccgcgcagaaaactgccgggtgtgggacgttgaaggc
cgtgagtatattgatttcgcaggcggcattgcggtgctcaataccggacatctgcatccg
aaagtggtggcggcggtggaagcgcagttgaaaaaactgtcgcacacctgcttccaggtg
ctggcttacgagccgtatctggagctgtgcgagatgatgaatcagaagataccaggtgat
tttgccaaaaaaacgctgctggtgacgacaggttccgaagcggtggaaaatgcggtgaaa
atcgcccgcgccgccaccaaacgtagcggcaccatcgcttttagcggcgcgtatcacggg
cgcacacactatacactggcgctgaccggcaaggtgaatccgtactctgcgggcatgggg
ctgatgccggggcatgtttatcgcgcgctttacccttgcccgctgcatggcatcagtgaa
gatgacgctatcgccagtatccaccgaatttttaaaaatgacgctgcgccggaagatatc
gccgccatcgtgattgaaccggttcagggcgaaggcggtttctacgccgcaacgcctgcc
tttatgcagcgtttacgcgagctgtgtgacgagcacgggatcatgctgattgccgatgaa
gtgcagagcggtgcggggcgtaccggcacgctgtttgcgatggaacagatgggcgtggcg
ccggatctcaccacctttgcgaaatccatcgcaggcggtttcccgctggcaggcgtcacc
gggcgcgctgaagtgatggacgctgtcgcaccgggcggcctgggcggcacctatgcgggt
aatccgattgcctgcgtggcggcgctggaagtgttgaaggtgttcgagcaggaaaatctg
ctgcaaaaagccaacgacctggggcaaaagctaaaagacggcttattggcgatcgccgaa
aaacacccggagatcggcgacgtacgcgggctgggggcgatgattgccatcgaactgttt
gaaggtggcgatcatagtaaaccggacgcaaaactcaccgccgagatcgtggcacgcgcc
cgcgataaaggcctgattcttctctcctgcggcccgtattacaacgtgctgtgcatcctt
gtaccgctcaccattgaagacgctcagattcgtcagggtctggagatcatcagccagtgt
tttgctgaggcaaaacagtag

DBGET integrated database retrieval system