KEGG   Escherichia albertii: EAKF1_ch3689cHelp
Entry
EAKF1_ch3689c     CDS       T03986                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
eal  Escherichia albertii
Pathway
eal00220  Arginine biosynthesis
eal00250  Alanine, aspartate and glutamate metabolism
eal00290  Valine, leucine and isoleucine biosynthesis
eal01100  Metabolic pathways
eal01110  Biosynthesis of secondary metabolites
eal01130  Biosynthesis of antibiotics
eal01210  2-Oxocarboxylic acid metabolism
eal01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAKF1_ch3689c
   00290 Valine, leucine and isoleucine biosynthesis
    EAKF1_ch3689c
   00220 Arginine biosynthesis
    EAKF1_ch3689c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:eal01007]
    EAKF1_ch3689c
Enzymes [BR:eal01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     EAKF1_ch3689c
    2.6.1.66  valine---pyruvate transaminase
     EAKF1_ch3689c
Amino acid related enzymes [BR:eal01007]
 Aminotransferase (transaminase)
  Class I
   EAKF1_ch3689c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Aminotran_MocR Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHE61529
UniProt: W0AYR9
LinkDB All DBs
Position
complement(3870514..3871731)
Genome map
AA seq 405 aa AA seqDB search
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAAMAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
MPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDVKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgtcccccattgaaaaatccagcaaactagaaaatgtctgctatgacatccgcggtcca
gtgctaaaagaagcaaaacgcctggaagaagaaggtaacaaggtattgaaattgaacatc
ggcaaccctgccccgttcggtttcgacgcgccagatgagatcctcgtcgacgtgatccgc
aatctgcccacggcacaaggttattgcgattcgaaaggtctctactctgcacgtaaagcg
atcatgcagcactaccaggctcgggggatgcgtgatgttaccgttgaggatatttacatc
ggcaatggtgtatcagagctaatcgttcaggcgatgcaagcgttactgaacagcggtgat
gaaatgttggtcccggcccctgattatccgttatggactgcagccgtttcactctccagc
ggtaaagctgtgcattatctttgcgacgagtcttctgactggttcccggatctcgatgat
attcgcgccaaaattacgccacgcacgcgcgggatcgtgattatcaacccgaacaaccca
acgggcgcggtgtattccaaagagcttttaatggagattgttgagattgcgcgccagcat
aatctcattatcttcgctgatgaaatttacgacaaaattctctatgacgacgcagagcat
cactcgattgctgcaatggcgccagacctgctgaccatcacctttaacggtttatcgaag
acctatcgcgtggcgggcttccgtcagggctggatggtgctgaacggaccgaaaaaacac
gctaaaggatacatcgagggtcttgagatgttggcctcaatgcgcctttgcgccaacgtt
ccggcacaacacgcaatacagaccgcgctgggcggctatcagagtatcagcgaatttatc
atgccgggcgggcgcctctatgaacagcgtaaccgcgcctgggaactgattaacgatatt
cctggcgtttcctgcgtgaaaccgcgtggcgcgctgtatatgttcccgaaaattgacgtc
aaacgctttaatattcacgatgaccaaaaaatggtgctggatttcctgttgcaggaaaaa
gtgctgctggtacagggaacggcattcaactggccatggccggatcacttccgtatcgtg
acgctgcctcgggtcgatgatatcgaactgtccttaagtaaattcgcccgtttcctttcc
ggttatcatcagttgtaa

DBGET integrated database retrieval system