KEGG   Escherichia albertii: EAKF1_ch3755cHelp
Entry
EAKF1_ch3755c     CDS       T03986                                 

Definition
(GenBank) putative superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eal  Escherichia albertii
Brite
Enzymes [BR:eal01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EAKF1_ch3755c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AHE61595
UniProt: W0AZ81
LinkDB All DBs
Position
complement(3941844..3942365)
Genome map
AA seq 173 aa AA seqDB search
MIKKILAVTALLSGAVMADTMTIPVNLVSSEGVGKNIGEITISETSYGLLFTPHLKELPP
GLHGFHIHENASCDPGLINGKKVPALAAGGHYDPEQTNKHLGPYNPEGHLGDLPALYVNS
EGNAENPVLSPKIKKISQIKERAIMIHAGGDNHSDSPAPLGGGGARLACGIIK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaaatacttgctgtaactgcgctacttagtggagccgtaatggctgataca
atgacgatccctgtaaatctcgtttcctcagaaggagtagggaaaaatataggggaaata
actatttcagaaaccagctacggattgctgttcactcctcatctgaaagaactgccacca
gggttacatggctttcatatccatgaaaatgccagttgtgatcccggtctgattaatgga
aaaaaagtgccagctcttgctgccggtgggcattatgatcctgaacaaacaaataaacat
cttgggccgtacaatccggagggccatctgggtgatctaccagcactctatgtcaactca
gaaggaaatgcagaaaacccggttctgagtccaaaaataaaaaaaataagccagataaaa
gaacgggcgatcatgattcatgccggaggggataatcattccgattcacctgctcctctg
gggggtgggggcgcaagactggcatgcggaataattaaataa

DBGET integrated database retrieval system