KEGG   Escherichia albertii: EAKF1_ch3958
Entry
EAKF1_ch3958      CDS       T03986                                 

Definition
(GenBank) T3SS effector protein NleD
  KO
K23656  T3SS secreted effector NleD
Organism
eal  Escherichia albertii
Pathway
eal05130  Pathogenic Escherichia coli infection
Brite
KEGG Orthology (KO) [BR:eal00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    EAKF1_ch3958
SSDB
Motif
Pfam: Peptidase_M91
Other DBs
NCBI-ProteinID: AHE61782
UniProt: W0B052
LinkDB
Position
4164136..4164780
AA seq 214 aa
MSDTDIESLVKALSVQWIKNNPQLRFQGTDHNIYQQIEAALDKIGSTETGRVLLNAIESI
SRLKSETVVIHLNSSRLGVMAHRDIDAENHRGTGSDFHCNLNAVEYPCGEGISVVDFHAT
IVFHELLHVFHNLNGERLKVESSRPESQKYSPLLLEEARTVGLGAFSEEVLSENKFREEI
GMPRRTSYPHDSALIHDDNTVSLGFQQVRLHPLL
NT seq 645 nt   +upstreamnt  +downstreamnt
atgtcagatacagatatcgagtctcttgtaaaagcattgagcgttcaatggataaaaaat
aatccgcaacttcgtttccaggggactgatcataatatatatcagcagattgaagcagca
ctcgataagattggctctacagagacagggcgtgtactcctgaatgctattgaatcaata
tcccgacttaaatcagaaacagtggtaatacacctcaactcttccagactaggagttatg
gcacatagagatatagatgctgagaaccatcgggggactggttccgattttcactgtaat
ctgaatgcagttgaatatccctgtggggaggggattagcgtggtggactttcatgcgact
attgtttttcatgagttgctccatgttttccacaatttaaatggggagcgtttgaaagtt
gagagttcccgaccagaatcacaaaaatactctccacttttactcgaagaagccaggact
gttgggttgggggctttttcagaggaggtgctttcagaaaataaattccgcgaagagatt
gggatgccccgtagaacctcctacccgcacgactcagctcttattcatgatgacaataca
gtgagtctgggattccaacaggtaagactgcatccattgctttag

DBGET integrated database retrieval system