KEGG   Escherichia albertii: EAKF1_ch4416cHelp
Entry
EAKF1_ch4416c     CDS       T03986                                 

Gene name
gst
Definition
(GenBank) glutathionine S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eal  Escherichia albertii
Pathway
eal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAKF1_ch4416c (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eal02000]
    EAKF1_ch4416c (gst)
Enzymes [BR:eal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EAKF1_ch4416c (gst)
Transporters [BR:eal02000]
 Other Transporters
  Pores ion channels [TC:1]
   EAKF1_ch4416c (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N GST_N_3 Glutaredoxin2_C GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: AHE62226
UniProt: W0AVE9
LinkDB All DBs
Position
complement(4586808..4587413)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLVSVDLMKKRLENGDDYFAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRHLLASVNSISRYKTIEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRAQLEKKLQYVNDTLKDGHWICGQRFTIADAYLFTVLRWAYGVKLNLEGLEHIAA
YMQRMAERPAVKAALTAEGLQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggcgcctgctctcttgcctcccatatcactctgcgtgag
agcggaaaggactttacgctcgtcagcgtggatttaatgaaaaaacgtctcgaaaatggt
gatgattactttgccgttaacccgaagggacaggttcctgcgttgctgctggatgacggt
actctgttgacagaaggtgtagccattatgcaataccttgccgacagcgtccccgatcgc
catttgctagcgtcagtgaacagtatttctcgctacaaaaccatcgaatggctgaactat
atcgccaccgaactgcataagggatttactccgctgtttcgaccggatacgccggaagaa
tacaaaccgacggtgcgcgcgcaactggagaagaaactgcaatatgttaacgatacactc
aaagatgggcactggatctgcgggcaacgtttcaccattgccgacgcctatctgtttact
gtgttgcgctgggcatacggagtgaaactgaatctggaaggtctggagcatatcgccgca
tatatgcagcgaatggctgaacgtccggcggtcaaagccgcactgacggcggaaggattg
cagtaa

DBGET integrated database retrieval system