KEGG   Erwinia amylovora CFBP1430: EAMY_0142Help
Entry
EAMY_0142         CDS       T01197                                 

Gene name
ppc
Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00620  Pyruvate metabolism
eam00680  Methane metabolism
eam01100  Metabolic pathways
eam01120  Microbial metabolism in diverse environments
eam01200  Carbon metabolism
Module
eam_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAMY_0142 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    EAMY_0142 (ppc)
Enzymes [BR:eam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     EAMY_0142 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBA19084
UniProt: D4HUG1
LinkDB All DBs
Position
complement(163581..166232)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKDALGENILDRVETIRQLSKSSRAGNDAHRQQLLSTL
QNLSNDELLPVARAFSQFLNLTNVAEQYHTISPNGEGAKNPELLAKTFQRLKQQPGLTEA
AVHEALGSLSLELVLTAHPTEITRRTLIHKLVEVNSCLKQLDHNDLSDYEHAQIMRRLRQ
LVAQAWHTDEIRKYRPSPIDEAKWGFAVVENSLWEGVPQFLRELNEQVEAAFGYTLPVDF
VPVQFTSWMGGDRDGNPNVTADITRHVLQLSRWKATDLFLRDIAVLISELSMSECTPEVR
ALCGNPEALEPYREIMKNLRSQLNGTQAYLAACLQGERVARPANLLISNEQLWAPLYTCY
QSLQACGMGIIANGQLLDTLRRVKCFGVPLVRIDIRQESTRHTEAIAEITRYLGLGDFES
WSEADKQAFLIRELNSKRPLTPRQWEPSAETQEVLDTCRVAAEAPQGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGYAMPVAPLFETLDDLNNANEVMSQLLSIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGITLTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTGAILEANLLPPPEPKPEWISIMDRL
SAVSCKMYRGYVREHADFVPYFRSATPEQELAKLPLGSRPAKRRPSGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQQAMADGQQDQLEAMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVDKSLWPLGKQLRDRLESDIKAVLTIANDAHLMADQPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEAAGSEPDARVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgaagtaatgtcagtatgctcggcaaactgctcggg
gatacgattaaggatgcgctgggagagaacatcctcgaccgggtagaaaccattcgtcaa
ctctctaagtcatctcgtgcgggtaatgacgctcaccgtcagcaactgctttccacgctg
caaaatctgtctaacgatgagctgttgccggttgcgcgcgctttcagccagtttctgaat
ctgaccaacgttgccgagcagtaccacaccatttcgcctaacggcgagggcgcaaagaac
ccggaactgctggcgaagacttttcagcgcctgaagcagcagccgggcctgaccgaagct
gccgttcatgaagcacttgggtccctgtcgctggagctggtgctgaccgcgcacccgact
gaaattacgcgccgtaccctgatccacaagctggtggaagtgaacagctgccttaagcag
ctggaccacaatgacctgtcagactacgagcatgcacagatcatgcgccgcctgcgtcag
ctggtggctcaggcgtggcataccgacgaaatccgtaaataccgtccttcaccgatcgat
gaggccaaatggggcttcgcggtggtggaaaacagcctgtgggaaggtgtccctcagttc
ctgcgcgagctgaacgagcaggtggaagccgcttttggttacaccctgccggtcgacttt
gtcccggtgcagtttacctcatggatgggaggcgaccgtgacggcaacccgaacgtcacc
gccgatatcacccgccacgtcctgcaacttagccgctggaaagcgaccgacctgttcctg
cgcgatatcgcggtactgatttccgagctgtcgatgtccgagtgtacgccggaagtgcgc
gcactgtgtggcaacccggaagcgctggagccgtaccgcgagatcatgaaaaacctgcgt
agccagctgaacggcactcaggcttatctggctgcctgcctgcagggcgaacgtgtagcg
cgccctgccaacctgctgatctctaacgaacagctgtgggccccgctgtatacctgctac
cagtcattgcaggcctgcggcatgggcattatcgctaacggccagctgcttgataccctg
cgccgcgtgaagtgctttggcgtgccgctggtgcgcatcgatatccgccaggagagtacc
cgccacaccgaagcgattgctgaaatcacccgctatctcggcctgggtgacttcgagagc
tggtcagaagccgacaagcaggcgtttctgatccgcgagctgaattctaaacgcccgttg
acgccgcgtcagtgggaacccagcgccgaaacccaagaggtgctggatacctgtcgcgtg
gccgcggaagcgccacaaggatcgattgcggcctatgttatctcaatggcgaaaacgccg
tctgacgtgctggcggtgcatctgctgttgaaagaagcggggattggctatgccatgccg
gtggcgccgctgtttgaaaccctcgacgacctgaataatgccaacgaggtaatgagccag
ttactgagtatcgactggtatcgcggcctgattcagggcaagcagatggtgatgattggt
tactctgactcggcaaaagatgccggtgtcatggcggccagctgggcgcagtatcaggca
caggacgcgctgatcaaaacctgtgagaaagccggtatcaccctgacgctgttccacgga
cgcggcggtagcattgggcgcggcggcgctccggcacatgcggcgctgctgtcccagccg
ccgggcagcctgaaaggcgggctgcgcgtcaccgaacagggtgagatgatccgcttcaag
tacggcctgccggaggtgaccatcagcagcctgtcgctgtacaccggggcgatcctcgaa
gccaacctgttgccgccgccggagccaaagccagagtggatcagcattatggatcggctg
tcggcggtctcctgcaagatgtaccgtggctatgtgcgtgagcacgcggacttcgtgccg
tacttccgctctgccacgccagagcaggagctggctaaactgccgcttggctcccgtccg
gcaaaacgccgtcccagcggcggcgttgaatcgctacgtgccattccgtggatcttcgcc
tggacgcagaaccgcctgatgctgcccgcctggctcggtgccggggctgcgctccagcag
gcgatggcagacggtcaacaggaccagctggaagccatgtgccgcgactggccatttttc
tctacccgcctggggatgctggagatggtgttctcgaaggccgacctgtggctggcggaa
tattacgatcagcgcctggtcgataaatcactgtggccgttgggcaaacagctacgcgat
cggctggagtcggatatcaaagcggtgctgaccattgccaacgatgcgcatctgatggcc
gaccagccgtggattgccgagtcgattgcgctgcgtaatgtttataccgacccgcttaac
gtattgcaggccgaactgctgcaccgctcacgccagcaggaagcagcgggcagcgagccg
gatgcccgcgtcgaacaggcgctgatggtgactattgctggcgtcgcggccggaatgcgt
aataccggttaa

DBGET integrated database retrieval system