KEGG   Erwinia amylovora CFBP1430: EAMY_2887Help
Entry
EAMY_2887         CDS       T01197                                 

Gene name
ddlB
Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00473  D-Alanine metabolism
eam00550  Peptidoglycan biosynthesis
eam01100  Metabolic pathways
eam01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    EAMY_2887 (ddlB)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAMY_2887 (ddlB)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    EAMY_2887 (ddlB)
Enzymes [BR:eam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EAMY_2887 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:eam01011]
 Precursor biosynthesis
  Amino acid ligase
   EAMY_2887 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATPgrasp_Ter TTL
Motif
Other DBs
NCBI-ProteinID: CBA22610
UniProt: D4HZZ2
LinkDB All DBs
Position
complement(2980181..2981101)
Genome map
AA seq 306 aa AA seqDB search
MAEKVAVLLGGTSAERDVSLLSGTAVLKGLQEAGIDAYPVDIRDFPVTRLKEEGFEKAFI
ALHGRGGEDGTLQGVLEFLNIPYTGSGVMASAITMDKLRSKYLWQGCGLPVSPFVALTRA
QMDAGLDAQVMASIDALGLPLFVKPSREGSSVGISRVNQASELQAALEEAFRFDHEVLVE
AFLSGPEYTVGVLGTDILPSIRIQTASEFYDYDAKYFSDETQYFCPSGLSADQEAELREL
TISAWNALGCSGWGRVDVMMGGDGRFYLLEVNTSPGMTSHSLVPMAAKQAGMSFSQLVAR
ILELAD
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaaagtagcggtattgctgggtggaacctccgcagagcgtgatgtttcgctg
ttgtccggcactgcggtcctgaaagggctgcaggaagcaggcattgatgcatatccggta
gacattcgtgattttccggtgacgcgcctgaaagaagagggcttcgaaaaagctttcatc
gcgctgcacgggcgcggtggtgaagatggcaccttacagggcgtactggagtttctgaac
atcccttataccggcagcggcgtgatggcctcggcgatcaccatggacaaactgcgcagc
aaatatttgtggcagggctgtgggctgccggtatcgccctttgtggcgctgacccgtgca
cagatggatgccggattggatgcacaggtgatggccagtatcgacgcgctggggttaccg
ctgttcgtcaaacccagccgtgaaggctccagcgtcggtatttcacgcgtgaatcaggcg
tcagagttacaggctgcgctggaagaggcgttccgttttgaccacgaagtgctggtagaa
gcgtttcttagcggcccggagtacaccgtgggcgtactgggcacagacattctgccctcc
atccgtattcagaccgccagtgaattctatgactacgatgctaaatacttttctgacgag
actcaatatttctgcccgtcaggactgagcgccgatcaggaagcggaattacgcgaactg
accatttcggcatggaatgcgctcggttgcagcggctggggccgcgtagatgtgatgatg
gggggcgacgggcgtttttacctgctggaggttaacacctccccggggatgaccagccac
agcctggtgccgatggcggcaaaacaggccggtatgagtttttcgcagctggtagcacgc
attctggaactggccgactga

DBGET integrated database retrieval system