KEGG   Erwinia amylovora CFBP1430: EAMY_3285Help
Entry
EAMY_3285         CDS       T01197                                 

Gene name
gstA
Definition
(GenBank) putative glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EAMY_3285 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eam02000]
    EAMY_3285 (gstA)
Enzymes [BR:eam01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EAMY_3285 (gstA)
Transporters [BR:eam02000]
 Other Transporters
  Pores ion channels [TC:1]
   EAMY_3285 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_2 GST_N_3 GST_C GST_C_2 GST_N_4 GST_C_3 Tom37
Motif
Other DBs
NCBI-ProteinID: CBA23399
UniProt: D4I292
LinkDB All DBs
Position
complement(3393153..3393815)
Genome map
AA seq 220 aa AA seqDB search
MITVHHLNNSRSQRVLWLLEELEVPYQIKCYQREASMLAPDELKKVHPLGKSPVITDGNR
VVAESGAILEYLAAHYDAEDRLKLFDDEEVIQSRYWLHYAEGSLMPLLVMKLIFSRMGKA
PVPWLLRPIGSAFGKGVQKGYIDPQLATHRQFIEQHLTSNEWFAGSRFSIADVQMSFPIQ
AMTARGGAAGSPAIQAWLEKVQCRAAWQRALDKGGEIHLV
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgatcactgtgcaccatcttaacaattcacgttcgcagcgagtgctgtggctgctggaa
gagctggaagtgccgtatcagattaaatgctatcagcgtgaggccagcatgctggctcct
gacgagctaaaaaaagtgcacccgctgggcaaatccccggttattaccgatgggaatcgc
gtggtggcggaatccggcgcgatcctggagtacctggcggcgcattatgacgccgaagat
cggctgaaactttttgatgatgaagaggtaatacaatcgcgttattggttgcactatgcc
gaaggttcattaatgccgttgctggtgatgaaactgatcttcagccggatgggtaaagcg
ccggtaccctggctgctgcgaccgattggtagtgcatttggtaaaggggtgcagaagggc
tatatcgatccccagttggccacccatcgccagtttatcgagcagcatctgaccagcaat
gagtggtttgccggcagtcgattcagcattgccgatgtgcagatgagctttccgatacag
gcgatgaccgcgcgcggtggtgccgctggcagccctgcgattcaggcctggctggaaaaa
gtgcagtgccgcgcggcctggcagcgcgctttggataaagggggcgaaattcaccttgtg
tga

DBGET integrated database retrieval system