KEGG   Ewingella americana: GXP68_08615
Entry
GXP68_08615       CDS       T06747                                 

Gene name
gstA
Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
eame  Ewingella americana
Pathway
eame00480  Glutathione metabolism
eame01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eame00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GXP68_08615 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eame02000]
    GXP68_08615 (gstA)
Enzymes [BR:eame01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     GXP68_08615 (gstA)
Transporters [BR:eame02000]
 Other transporters
  Pores ion channels [TC:1]
   GXP68_08615 (gstA)
SSDB
Motif
Pfam: GST_N GST_C GST_N_3 GST_N_2 GST_C_3 GST_C_2 GST_N_5 GST_N_4 Tom37
Other DBs
NCBI-ProteinID: QMV51411
LinkDB
Position
complement(1857674..1858279)
AA seq 201 aa
MKLYYKPGACSLSPHIVLREAGLDFSIVKVDLATKKTEHGDDFFAVNPKGQIPTLELNDG
TLLTEGVAIVQYLADQKPDRNLLPEFGTLARYHALEWLNYIATELHKGFSPLFNPKTPDD
FKAVTREALMKKFAYVNDELQGQQFLLGARFSVADAYLFTVMGWAKALKFDLSAFTDLNN
YLDRVAARPAVDAALTAEGLK
NT seq 606 nt   +upstreamnt  +downstreamnt
atgaaactttattacaaacccggcgcttgttccctttctccgcatatcgttctgcgtgaa
gccggtctggatttcagcatcgtcaaagtcgatttggcgaccaagaaaaccgaacacggc
gatgatttttttgccgttaaccctaaaggccagatcccaactctcgaactgaacgacggc
acattgctgactgaaggcgtggctatcgtgcagtatctggctgaccagaagccagaccgc
aacctgctgccagagtttggcactcttgcgcgctaccacgcgctggagtggctgaactac
atcgcgaccgagctgcataaaggcttcagcccgctgttcaacccgaagacgccggacgac
ttcaaagccgtgacccgcgaagcgctgatgaagaaattcgcctacgtcaacgacgagctg
caaggccagcaattcctgctgggcgcgcgctttagcgtggccgatgcttacctgttcacc
gtcatgggctgggccaaagccctgaagtttgatttgagcgctttcaccgacttgaacaac
tatctggaccgcgttgccgcgcgtccggcggtagacgccgcgctgactgccgaaggcctg
aagtaa

DBGET integrated database retrieval system