KEGG   Exiguobacterium antarcticum: Eab7_0680Help
Entry
Eab7_0680         CDS       T02258                                 

Gene name
sacA
Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00052  Galactose metabolism
ean00500  Starch and sucrose metabolism
ean01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    Eab7_0680 (sacA)
   00500 Starch and sucrose metabolism
    Eab7_0680 (sacA)
Enzymes [BR:ean01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     Eab7_0680 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AFS69827
UniProt: K0AAN4
LinkDB All DBs
Position
complement(706977..708437)
Genome map
AA seq 486 aa AA seqDB search
MNQWTREARYRPLSDLAPEVYQLMKEEVRTSPWRFSFHVQPPTGLLNDPNGFVYHDGTYH
LFYQWFPLGPVHGLKYWYHLTSKDLVHWFDEGAALIPNDDPDSHGAYSGSGFVKDDKVHI
MYTGNKRDQDWVRHTSQIVGHLRSDGRIEKHLPPAIATVPDGYTEHFRDPKVFQHQGTWY
CIIGAQRNDLTGATVVYHSEDAESWMLLGELNTRYPDFGYMWECPDYFELDGHGLLLFSP
QGIEPTGDHYQNIFQSGYFIGQTVDFPNLSYQHEDFLELDFGFDFYAPQTTLAADGRRIL
VGWMGLPDITYPSDRYKWAHALTLPRELTLEQGHLRQNPVRELTSLRKDTLYEQHLVVEQ
QASPVQAEVFELVLSHLAISSGQFELKVRASEQEETILRYDTQTKRFTMDRTRSGAEVPA
IEYGTTRSIPLTEPLHTLRLFVDRSSIEVFLNDGEAVASARIFPKSTSQGIVLSGKATAH
LAIYAL
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagtggacacgcgaagcacgctaccgcccactctccgatctcgcaccggaagtg
taccaactcatgaaagaagaagtccggacatccccttggcgcttctcttttcatgttcaa
ccaccaaccggattgttaaatgatccgaatggttttgtctatcacgatggtacgtaccac
ctattttatcaatggttcccactcggaccggttcatggattaaaatactggtatcatctg
acgtcaaaggatttggttcactggttcgatgaaggcgcggcactgatccccaatgatgat
cccgattcgcatggtgcctactctggtagtggcttcgtcaaggatgataaagtccatatc
atgtacacaggcaataaacgcgatcaggattgggtccggcatacaagccaaatcgttgga
catcttcgttcagatggtcggattgaaaaacatcttcctccagcaatcgcaacggtacct
gatggttataccgaacatttccgggatccgaaagtgttccaacatcaagggacatggtat
tgtatcatcggtgcccagcgaaatgatttgaccggcgctacggtcgtctatcactcggaa
gatgctgaatcctggatgttactcggagaactgaatacacgttatccggacttcggctat
atgtgggaatgtcccgattattttgagctggatgggcacggattgttgctctttagtcca
caaggcatcgaaccgacaggggaccactaccaaaacattttccaatccggttacttcatc
ggtcagacggtcgacttcccgaatctgtcttatcaacatgaagactttttagaacttgat
tttggttttgatttttatgcaccccagacgacgttagcagcagacggtcgccggattctc
gtcggttggatgggtttacccgatatcacgtatccaagtgatcgttataaatgggcgcac
gctttgacactgccacgagaattgacactcgaacaggggcatttacgccaaaatccggtc
cgcgaactaacctctctacgaaaagacaccctgtatgaacaacatcttgtagtcgaacaa
caggcaagtcctgtccaagcggaagtctttgaactggtcctgtctcatcttgctatttct
tccggacagttcgaattaaaggttcgtgcgagtgagcaagaagaaacgattctgcggtat
gatacacagacgaaacgatttacaatggatcgtacacggtctggcgcagaggttcccgct
atcgaatacggaacgacgcgttccatcccgttaactgaaccactgcacacgctgcggctg
ttcgtcgaccgttcgtcgatcgaagtcttcttgaacgacggagaagcggtggcttctgcc
cgtatcttcccgaaatcaaccagtcaaggaattgtcttaagcggtaaagcaactgcccac
cttgcgatttatgcactctga

DBGET integrated database retrieval system