KEGG   Exiguobacterium antarcticum: Eab7_1004Help
Entry
Eab7_1004         CDS       T02258                                 

Gene name
tdh
Definition
(GenBank) L-threonine 3-dehydrogenase
  KO
K00060  threonine 3-dehydrogenase [EC:1.1.1.103]
Organism
ean  Exiguobacterium antarcticum
Pathway
ean00260  Glycine, serine and threonine metabolism
ean01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ean00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Eab7_1004 (tdh)
Enzymes [BR:ean01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.103  L-threonine 3-dehydrogenase
     Eab7_1004 (tdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C TrkA_N Methyltransf_25 Gp_dh_N MTS Methyltransf_11 Met_10 ApbA
Motif
Other DBs
NCBI-ProteinID: AFS70145
UniProt: K0AB48
LinkDB All DBs
Position
1032056..1033147
Genome map
AA seq 363 aa AA seqDB search
MMTKLVTAVEDTTKVKTMRALVKEERGFGAVLKEVAVPTPNRGEVLIRVEATSICGTDVH
IYEWDAWAASRVNPPYVFGHEFSGEVVELGEGTKRLKLGDRVSAETHIVCHQCKQCLRGQ
YHICKNTKIIGVDTQGCFAEYVVMPEENLWVNPEDMPAGIASIQEPMGNAVHTVLASDVS
AKTVAIVGCGPIGLMAVSVAKAAGAAEVVAIDVNPYRLELAKTMGADVVIDSRHEDVLER
VRMMTDGDGIDVVCEMSGHPVAIGQAFEMVTAGGDVNILSLPVKPVEIDLTNHVVFKGVR
VQGITGRKMYETWSQVSAFLSSGKVDVKPLITHTLPLERFEEGFELMRQGKCGKVVLQPR
GTN
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgatgacaaaattagtgacagctgtagaggatacgacgaaggtgaaaacgatgcgggcg
ctcgtcaaggaagaacgtgggtttggcgccgtcttaaaagaagtcgccgtcccaacaccg
aaccggggcgaagtgttgatccgggtcgaagcgacatcaatctgcgggacggatgtccac
atctacgaatgggatgcttgggcggcgtcacgcgtcaatccgccctatgtcttcggacat
gagttttcaggcgaagtcgtggagctgggggaagggacaaaacgtctgaaactcggtgac
cgggtctcggctgagacgcatatcgtctgtcatcaatgtaaacaatgtttacgcgggcaa
taccatatttgtaaaaacacaaaaattatcggcgtcgatacgcaaggctgtttcgccgag
tacgtcgtcatgccggaagaaaacctctgggtcaatccggaagatatgccagccggcatc
gcgtcgattcaagagccgatgggcaatgccgtccatacggtgctcgccagtgacgtcagt
gccaagacggtggcaatcgttggttgcggtccaatcgggttgatggcagtatccgtcgca
aaagcggcaggggcggcagaagtcgtggcgattgatgtcaatccataccgactcgaactt
gcgaagacgatgggggcagatgtcgtcatcgactcacgtcatgaagatgttcttgaacgc
gtccggatgatgaccgacggcgacggcattgatgtcgtctgcgaaatgagcggtcatccg
gtcgccatcggtcaagcattcgagatggtgacggcaggcggagatgtcaatatcttgagt
ctgccggtcaaaccggtcgaaatcgatttgacgaaccatgtcgttttcaaaggagtccgc
gttcaggggattaccggacggaagatgtatgagacatggagtcaggtgtctgccttcttg
tcgagcggaaaagtcgatgtgaagccgttgatcacgcatacgttaccactcgaacggttt
gaagaaggattcgaattgatgcgacaagggaaatgtggaaaggtcgtactacaaccaagg
gggacgaattga

DBGET integrated database retrieval system