KEGG   Exiguobacterium antarcticum: Eab7_1773Help
Entry
Eab7_1773         CDS       T02258                                 

Gene name
prkC
Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ean  Exiguobacterium antarcticum
Brite
KEGG Orthology (KO) [BR:ean00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ean01001]
    Eab7_1773 (prkC)
Enzymes [BR:ean01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     Eab7_1773 (prkC)
Protein kinases [BR:ean01001]
 Serine/threonine kinases: Other
  Bacterial family
   Eab7_1773 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kdo RIO1 Kinase-like FTA2 DUF4366
Motif
Other DBs
NCBI-ProteinID: AFS70881
UniProt: K0AEA2
LinkDB All DBs
Position
complement(1727589..1729514)
Genome map
AA seq 641 aa AA seqDB search
MRYGDRLNDRYRIERLVGNGGMANVYQAYDEILNRTVAIKILRTEFSHDEQFIRRFEREA
HAATSLNHPNIVAVYDVGEEEAIYYIVMEYIDGMTLKTYCEGQALPVSKAIDIIRQICDA
IDHAHAHRIIHRDIKPQNMLVREDGTVKVTDFGIAVAMSNATLTHTMSVLGSVHYFSPEQ
AKGKFADEKSDIYSLGAVLYELVTGQVPFEGDSPVAVALKHLQDTARRPTALNPAVPQAL
ENCIMQALAKAPHDRQQSVAAFKEDMITAMSAERANEGIRGDDQMEQTMVLSPVSLPTED
TAQTASIPKVATVTPKPEKKKKRGWWWVLLILLLVGGAATTFAMWPDPTVVVPDVAGEDA
DEAETTLEKLGFLVESTERSSDTVEEGFVISQSPREKATVKKGSTVNLVVSTGSDPVEVP
DVTDETEKKAIAILKDSGFEKVDIEREESEDIKRGNVIRQSISAGTEVIAKEQMITITVS
NGSSTFVLKDLTDLSSAEAKAYLDETGLDGTFEQEFSSDVALDQVIRQYPQAGAQVEPND
SVTVFISRGEEEKTVTATFPEKVVYDGISEEEEPAPRQVIRIETEDAKGKRTVIEESIDQ
DETFDVPLTIDPGDEGKITIYKDDEVYRSKTITYNQAKSQE
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgcgttacggagatcgattgaacgaccgctaccgcatagaacggttagttggaaatggc
ggaatggcaaacgtttatcaggcatatgatgaaatcttgaatcgaactgtcgcaatcaaa
attttacgtactgagttttcacacgatgaacaattcattcggcgatttgaacgagaagca
catgctgcgacaagtttaaatcatccaaatatcgttgcggtgtatgatgtaggggaagaa
gaagccatttattatatcgtgatggaatacatcgacgggatgacactgaaaacctattgt
gaaggtcaggccttaccagtgtcaaaagcgattgacatcattcgtcagatttgtgatgcg
attgaccacgcgcatgcgcatcggatcatccatcgcgacattaaaccacagaacatgctt
gtccgtgaggatgggaccgtaaaagttacggatttcggaatcgccgtcgccatgtcaaat
gcaaccttgacgcatacgatgtctgtcttaggatcggttcattacttttcaccagaacag
gcaaaaggaaaatttgccgatgaaaaatcagatatttattcgctgggagctgtcctgtat
gaactcgtgaccggacaagttccgttcgaaggcgattcgccggtggctgtcgccttgaag
caccttcaagacacagcacggcgaccgacggcactaaatcctgccgtcccacaagcactc
gagaattgtatcatgcaagccttggcgaaggccccacacgatcgacaacagtcagtcgca
gcgttcaaggaagacatgataaccgcgatgtctgccgagcgagcaaatgaagggattcgc
ggagacgatcaaatggaacaaacgatggtactcagcccggtttccctaccgacagaagat
actgcacagacagcatcgatcccgaaagtcgcaaccgtcactccgaaaccggaaaagaag
aaaaaacgcggctggtggtgggtcttgctgattcttttattagtagggggagcggcgacc
acgtttgcgatgtggcctgatccgacagtcgttgttccggatgtggcaggggaagatgcg
gatgaagcagaaacgacacttgagaaactaggttttctcgtcgagtcgaccgaacgctca
agtgatacggtggaagaaggtttcgtcatcagtcaatctccacgcgagaaagcaaccgtc
aaaaaaggttcgaccgtcaatcttgttgtttcgacaggaagtgatccggttgaagttccg
gatgtgacagatgagacagagaaaaaagccattgccatacttaaggatagtggatttgag
aaagtcgatatcgaacgagaagagtcagaagacatcaaacgtgggaacgtcatccgacag
tcgatttcagctggaacagaagtcattgccaaagaacagatgatcacgatcacggtttca
aacggatcgtcgacgtttgtcttaaaggatctgacagacttgtcgagcgccgaagcgaaa
gcttatcttgacgagacgggactagacggaacgtttgaacaagaattctcaagtgacgtc
gcgctggatcaagtgattcgacagtacccgcaagcgggtgcgcaagtggaacccaatgat
tcggtgaccgtcttcatctcacgtggcgaagaagaaaaaacggttacggctacattccct
gaaaaagtggtgtatgatggcatcagtgaagaagaagaacccgctcctcgtcaagtcatc
cggattgaaacggaggacgcgaagggcaaacgaacagtcatcgaagaatcgattgatcaa
gatgaaacatttgatgttccgttgacgattgatccaggtgacgaaggaaagattacgatt
tataaagacgatgaagtatatcgctccaaaacgattacgtacaatcaggcaaaatcacaa
gaataa

DBGET integrated database retrieval system